KEGG   Catenulispora acidiphila: Caci_5345Help
Entry
Caci_5345         CDS       T00967                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cai  Catenulispora acidiphila
Pathway
cai00230  Purine metabolism
cai01100  Metabolic pathways
Module
cai_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Caci_5345
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Caci_5345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 AAA_28 AAA_30 AAA_5 RsgA_GTPase AAA MMR_HSR1 NTPase_1 NACHT AAA_24 NB-ARC AAA_29 ABC_tran cobW RNA_helicase TsaE
Motif
Other DBs
NCBI-ProteinID: ACU74204
JGI: Caci_5345
UniProt: C7Q837
Position
complement(6160343..6160957)
Genome map
AA seq 204 aa AA seqDB search
MSDRAGTDGHGSDTSAPAPALLTVLSGPSGVGKTTLAKHVREAHPQVWLSVSATTRTPRP
GEVDGVHYFFYDRPAFEDLIAEGAFLEHAEYAGNLYGTPRRAVEQRLEAGQPVLLEIELQ
GARQIRAAMPAARLVFLAPPSWEVLEQRLRGRGTEPEAVIAERLATGRVELAAESEFDVT
IVNTTVEAAAEELVELVTGAGSRA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgcgccggaacggacggccacggttccgacacctcagcccctgcccccgca
ctgctgacagtgctctcgggcccgtcgggcgtcggcaagacgacccttgccaagcatgtg
cgcgaggcccacccccaggtgtggctgtcggtctcggccaccacgcgaaccccccgcccc
ggcgaggtggacggcgtgcactacttcttctacgaccggcccgccttcgaggacctgatc
gccgagggcgctttcctggagcacgccgagtacgccggcaacctgtacggcaccccgcgc
cgggccgtcgagcagcgcctggaagccggccagcccgtgctgctggagatcgagctgcag
ggcgcgcgccagatccgcgccgcgatgcccgccgcccgcctggtcttcctggctccgccc
tcctgggaggtgctcgagcagcggctgcgcggccgcggcaccgagccggaggccgtgatc
gccgaacgcctggccaccggccgggtggaactggccgccgagagcgagttcgacgtcacc
atcgtcaacaccacggtcgaggccgccgccgaggaactggtcgagctggtcaccggtgcg
gggtccagggcctga

DBGET integrated database retrieval system