KEGG   Catenulispora acidiphila: Caci_5471Help
Entry
Caci_5471         CDS       T00967                                 

Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
cai  Catenulispora acidiphila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Caci_5471
   01230 Biosynthesis of amino acids
    Caci_5471
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Caci_5471
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Caci_5471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6309014..6310048)
Genome map
AA seq 344 aa AA seqDB search
MHMTYTAAVAGATGYAGGELLRLLLGHPDFQIGALTAGTSAGTRLGEHQPHLAPLADRVV
ADTTPETLAGHDVVFLALPHGQSAAIAEALGPDTLIVDCGADYRLADAGVWEKFYGSPHA
GTWPYGLPELPGARAALTGAKRVAVPGCFPTVSTLALAPAVGAGLVEPDVVVVAATGTSG
AGKSLKPNLLGSEIMGNVAAYNIGGVHRHSPEIAQNLGAVAGQAVTVSFTPLLVPMPRGI
LATCTAKVKPGVGEEQLRDAYLKAYGDEPFVTVLPQGQLPTTAAVLGANTVQIQVAFDEA
AGRAVVVGAIDNLTKGTAGGALQCANLALGLPEPAGLSTVGIAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgacctacacggcggcggtggccggagccaccggctacgcgggcggcgagctg
ctgcggctcctgctcgggcatccagacttccaaataggcgcgctcaccgcggggacgagc
gccgggacccgattgggcgagcaccagccgcatctggcgccgctggccgaccgcgtggtc
gccgacaccacgccggagacgctggccgggcacgacgtcgtcttcctcgccctgccgcac
ggacagtccgccgcgatcgccgaagcgctgggaccggacaccctgatcgtcgactgcggc
gccgactaccgcctcgccgacgccggggtctgggagaagttctacggctccccgcacgcc
gggacctggccctacggcctgcccgagctgcccggcgcgcgcgccgcgctcaccggcgcc
aagcgggtcgccgtccccggatgcttcccgaccgtctccacgctcgcgctcgccccggcc
gtcggcgccgggctggtcgagccagacgtggtcgtggtcgccgcgaccgggacctccggc
gccggcaagtccctgaagccgaacctgctcggctcggagatcatgggcaacgtcgccgcg
tacaacatcggcggcgtccaccggcacagcccggagatcgcgcagaacctcggcgcggtc
gcgggacaagcggtgaccgtgtccttcacgccgctgctggtccccatgccgcgcgggatc
ctcgccacctgcaccgcgaaggtgaagccgggcgtcggcgaagagcagctgcgggacgcc
tatctgaaggcgtacggcgacgagccgttcgtgaccgtcctgccgcaggggcagctgccc
acgacggccgcggtcctcggagcgaacaccgtgcagatccaggtcgcgttcgacgaggcg
gccgggcgcgccgtcgtcgtcggcgcgatcgacaacctcaccaagggcaccgccggcggc
gccctgcagtgcgccaacctcgcgctcggcctgccggagcccgccggtctgagcaccgtc
gggatcgcgccgtga

DBGET integrated database retrieval system