KEGG   Catenulispora acidiphila: Caci_5606Help
Entry
Caci_5606         CDS       T00967                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_5606
   01230 Biosynthesis of amino acids
    Caci_5606
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_5606
   00051 Fructose and mannose metabolism
    Caci_5606
   00562 Inositol phosphate metabolism
    Caci_5606
Enzymes [BR:cai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caci_5606
Exosome [BR:cai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caci_5606
  Exosomal proteins of bladder cancer cells
   Caci_5606
  Exosomal proteins of melanoma cells
   Caci_5606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6461585..6462376)
Genome map
AA seq 263 aa AA seqDB search
MTDRKPLMAGNWKMNLNHFEAMKHVQELAFSLTDKDFDAVDVAVLVPFTDLRSVQTLVQG
DKLRIQYGAQDVSQHPSGAYTGDISAPMLAKLDCHYVIVGHSERRQYHGETDALVAAKAV
AARKHGITPIVCVGEHLQVRKDGAHVAHCVEQTRGSLAGLSAEQVQASVIAYEPVWAIGT
GEVATPEDAQEVCAAIRTELATLFDESVAANTRILYGGSVKGANAAELMAQPDVDGALVG
GASLDAADFTRIVRFRDSAVAAG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccgcaagccgttgatggctggcaactggaagatgaacctcaaccacttcgag
gccatgaagcacgtccaggagttggcgttctcgctgacggacaaggacttcgacgccgtc
gacgtggcggttctggtgcccttcaccgacctccgctcggtccagaccctggtgcagggc
gacaagctgcgcatccagtacggcgcgcaggacgtctcccagcacccctcgggcgcctac
accggcgacatctccgcgccgatgctggccaagctggactgccactacgtgatcgtcggc
cactccgagcgccgccagtaccacggcgagaccgacgcgctggtcgcggccaaggccgtc
gccgcgcgcaagcacgggatcacgccgatcgtctgcgtcggggagcacctgcaggtccgc
aaggacggcgcgcacgtcgcgcactgtgtcgagcagacccgcggctcgctcgccgggctc
agcgccgagcaggtccaggcctcggtcatcgcctacgagccggtctgggcgatcggcacc
ggcgaggtcgcgacgccggaggacgcccaggaggtgtgcgccgcgatccggaccgagctg
gccacgctgttcgacgagagcgtcgcggcgaacacccggattctctacggcggctcggtg
aagggcgccaacgccgccgagctgatggcgcagcccgacgtcgacggcgcgctggtcggc
ggggcgtcgctggacgccgcggacttcacgcggatcgtgcgtttcagggattctgctgtc
gccgctggctga

DBGET integrated database retrieval system