KEGG   Catenulispora acidiphila: Caci_5709Help
Entry
Caci_5709         CDS       T00967                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caci_5709
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_5709
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caci_5709
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Caci_5709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(6590199..6591008)
Genome map
AA seq 269 aa AA seqDB search
MNRLQDVLKSARADNRAVLIGYLPAGYPSVDGSIDAMRAMVEGGCDIIEVGLPYSDPAMD
GPVIQAAADQALSRGVTTPDVIRAAGAVADTGAAALIMSYWNPIEHYGVERFAAELAAVG
GSGVITPDLIPEEAGPWVAATDAHDIGRVFLVAPSSTPERVALTTEVCNGFVYAGAVMGV
TGARDQVGHAARDLVERTRKATDQAVCVGLGVSTGDQAAEIAGYADGVIVGSAFVRRLLD
NRDPRKGVEAVRELAAELADGVRRGSKAR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccggctccaggacgtgctcaaaagcgcgcgggcggacaaccgcgcggtcctcatc
ggctacctgcccgcgggctacccgtcggtcgacggctccatcgacgccatgcgcgccatg
gtcgagggcggctgcgacatcatcgaggtcggactcccgtactccgacccggcgatggac
ggcccggtcatccaggccgccgccgaccaggcgctcagccgcggggtcaccaccccggac
gtgatccgcgcggccggcgcggtcgccgacaccggcgcggcggcgctgatcatgtcgtac
tggaacccgatcgagcactacggcgtcgagcgcttcgccgccgagctggcggcggtcggc
ggcagcggcgtgatcaccccggacctcatccccgaggaggccggtccctgggtcgccgcg
accgacgcgcacgacatcggccgggtgttcctggtcgcgccgagctccacccccgagcgc
gtcgcgctgaccaccgaggtgtgcaacggcttcgtgtacgccggtgcggtgatgggcgtc
accggcgcccgcgaccaggtcgggcacgccgcccgggacctggtcgaacgcacgaggaag
gcgacggaccaggcggtgtgcgtgggcctgggggtctccaccggcgaccaggccgccgag
atcgccgggtacgccgacggcgtgatcgtcggctcggccttcgtccggcggctgctggac
aaccgcgacccgcgcaagggggtcgaggcggtgcgcgagctggccgccgagctcgccgac
ggggtgcggcgggggagcaaggcccgctga

DBGET integrated database retrieval system