KEGG   Catenulispora acidiphila: Caci_5710Help
Entry
Caci_5710         CDS       T00967                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cai01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cai00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cai00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6591005..6592327)
Genome map
AA seq 440 aa AA seqDB search
MSDQSDLHLSSAPDPRAEIISAYAATAAMPDDAGHFPTDDALFGGRFMPEALMAVLKEVT
EAYETSKTDPAFHREFADLLLHYANRPSLLTEARNLSRRAGARILLKREDLNHTGSHKIN
NVLGQALLAQRMGKTRLIAETGAGQHGVATATAAALLGLDCVVYMGSEDTKRQALNVARM
RMLGAEVVPVAIGSQTLKDAINEALRDWVASADTTYYLLGTAAGPHPFPAMVRDFARVIG
VEARRQTLELTGALPDAVAACVGGGSNAIGVFHAFVPDASVKLYGFEAGGSGVATGLHAA
SITGGSVGVLHGTRTFLLQDEYGQTKESHSISAGLDYPAVGPEHAWLHATGRAVYEPVDD
SEAMDAFRVLCETEGIIPAIESAHALAGALRVAPRLAAELGREPVIVVNLSGRGDKDMHT
AAAYFGVDFDDHGPSEGGEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcagtcagatctgcatctgtcttcggcgccggatccccgcgccgagatcatc
tccgcgtacgcggccaccgccgcgatgcccgacgacgccgggcacttccccaccgacgac
gccctattcggcggccgcttcatgcccgaggcgctgatggccgtgctgaaggaggtcacc
gaggcttatgagacctcgaagaccgacccggcgttccaccgggagttcgccgacctcctg
ctgcactacgccaaccgcccgagcctgctcaccgaggcccgcaacctctcccggcgggcc
ggcgcgcgcatcctgctcaagcgcgaggacctgaaccacaccggttcacacaagatcaac
aacgtcctcggccaggcactgctggcccagcgcatgggcaagacccggctcatcgccgag
accggcgccggccagcacggcgtggccaccgcgaccgccgcggcgctgctcggcctggac
tgcgtcgtctacatgggctcggaggacaccaagcggcaggcgctgaacgtggcgcggatg
cgcatgctcggcgccgaggtggtgccggtcgcgatcgggtcgcagaccctgaaggacgcg
atcaacgaggccctgcgcgactgggtcgccagcgccgacaccacctactacctgctcggc
accgccgccggcccgcaccccttcccggcgatggtccgcgacttcgcgcgggtcatcggc
gtggaggcgcgccggcagaccctggagctcaccggcgcgctgccggacgccgtcgcggcc
tgcgtcggcggcggctccaacgcgatcggcgtgttccacgccttcgtcccggacgcctcg
gtgaagctgtacggcttcgaggccggcggctccggcgtggcgaccggcctgcacgcggcc
tccatcaccggcggctcggtcggcgtcctgcacggcacccgcaccttcctcctccaggac
gagtacggccagaccaaggagagccacagcatctccgccggtctggactacccggccgtc
ggcccggagcacgcctggctgcacgccaccggccgcgccgtctacgaacccgtggacgac
agcgaggccatggacgccttccgcgtcctgtgcgagaccgagggcatcatccccgccatc
gaatccgcgcacgcgctggccggcgcactgcgcgtcgccccgcggctcgcggcagagctc
ggacgcgaaccggtgatcgtcgtgaatctttcagggcgcggcgacaaggacatgcacacg
gcggcggcgtatttcggtgtcgactttgacgaccatgggcccagcgaggggggagagctg
tga

DBGET integrated database retrieval system