KEGG   Catenulispora acidiphila: Caci_5711Help
Entry
Caci_5711         CDS       T00967                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cai  Catenulispora acidiphila
Pathway
cai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01130  Biosynthesis of antibiotics
cai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caci_5711
Enzymes [BR:cai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Caci_5711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACU74569
JGI: Caci_5711
UniProt: C7QCC1
Position
complement(6592506..6593330)
Genome map
AA seq 274 aa AA seqDB search
MNVLAEIIEGVRLDLAERQEKISLDDLKARVARMDSARDGVELLRRGGAGGDGVKVIAEV
KRSSPSKGALAAIADPAGLAADYEAGGATVISVLTEQRRFGGSLGDLDDVRKKVDIAVLR
KDFIVTSYQLWEARAHGADLALLIVAALEQPALESLIERAASIGLTPLVEVHDEEEVRRA
LDAGARLVGVNARDLKTLEVRRDTFARLAPLVPDGVVRVAESGVRGPHDLIAYANAGADA
VLVGESLVTGKDPRAAVADLVAAGAHPALRNGRG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtacttgccgagatcatcgaaggcgtccgcctcgaccttgccgagcgccaggag
aagatcagcctggacgacctgaaggcccgggtggcgcgcatggacagcgcccgcgacggg
gtcgagctgctgcggcgcggcggtgccgggggcgacggcgtgaaggtgatcgccgaggtg
aagcgctcctcgccgtccaagggcgcgctggccgcgatcgccgacccggccgggctggcc
gcggactacgaggccggcggcgcgaccgtcatctccgtgctcaccgagcagcgccgcttc
ggcggctcgctgggcgacctggacgacgtccgcaagaaggtcgacatcgcggtgctgcgc
aaggacttcatcgtcaccagctaccagctgtgggaggcccgcgcgcacggcgccgacctg
gcgctgctgatcgtcgccgcgctcgagcagccggcgctggagtcgctgatcgagcgcgcc
gcctccatcggcctgaccccgctggtcgaggtgcacgacgaggaagaggtgcgccgcgcg
ctggacgccggcgcccgcctggtcggcgtcaacgcccgcgacctgaagaccctcgaggtc
aggcgggacaccttcgcccggctggcgccgctggtcccggacggcgtcgtgcgtgtcgcg
gagtccggggtgcgcggaccgcacgacctcatcgcctacgccaacgccggcgccgacgcg
gtgctggtcggcgagtcgctggtgaccggcaaggacccgcgcgccgcggtcgccgacctg
gtcgccgccggtgcccacccggcgctgcgcaacggccgcggctga

DBGET integrated database retrieval system