KEGG   Catenulispora acidiphila: Caci_5730Help
Entry
Caci_5730         CDS       T00967                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cai  Catenulispora acidiphila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cai01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cai00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6609792..6611144)
Genome map
AA seq 450 aa AA seqDB search
MITRIDLRGRALDTDQTDPRALVPRAELDVEAALAVVRPIVEDVRHRGEAALIDYAAKFD
GVELTEVKVPAAALAEALERLDPQVRAALEESIRRARTVHRDQRRQDTTTQVVPGGSVTE
RWVPVDRVGLYVPGGRAVYPSSVVMNVVPAQEAGVGSLAVASPPQKEFGGLPHPTILAAC
ALLGVDEVYAAGGSQAIAMFAYGYREAAEGAEAQGAVVCRRADLVTGPGNIYVAAAKRLL
KGVIGIDAEAGPTEIMVVADASADAGVVAADLISQAEHDPLAAAVLVTDSEQLAEEVVKE
LETRVAATKHAERIREALAGRQSALVLVDDIGAALVVANGYAAEHLEIQTRNAAADAAKV
RNAGAVFVGSFAPVSLGDYLAGSNHVLPTGGCACHSSGLSVQSFLRGIHVVDYTREALAE
ASDLVVALANAEDLPAHGEAVTARFEERQG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgatcactcgaatcgacctgcgcggtcgcgctctggacacggaccagaccgatcctcgc
gccctggtgcccagggccgagctggacgtcgaggccgctctggccgtcgtccgcccgatc
gtcgaggacgtgcgtcatcgcggcgaggcggcgctcatcgactacgcggccaagttcgac
ggggtcgagctgaccgaggtgaaggtgcccgccgcggcgctcgccgaggcgctggagcgc
ctggacccgcaggtcagggcggcgttggaggagtcgatccggcgcgcgcgcaccgtgcac
cgggaccagcgccggcaggacacgaccacgcaggtcgttcccggcggcagcgtcaccgag
cgctgggtgccggtggaccgggtcgggctctacgtgcccggcggacgcgccgtgtatccg
tcctccgttgtgatgaatgtggtgcccgcgcaggaagccggtgtcggctccctcgcggtg
gcctcgccgccgcagaaggagttcggcgggctgccgcaccccacgatcctggccgcgtgc
gcgctgctcggcgtggacgaggtctacgccgccggcggctcgcaggccatcgcgatgttc
gcctacggctaccgcgaggcggccgagggcgccgaagcccaaggcgccgtcgtctgccgc
cgcgccgacctggtcaccggacccggcaacatctacgtcgccgcggccaagcggctgctc
aagggcgtcatcggcatcgacgccgaggccggtccgaccgagatcatggtcgtcgccgac
gcctccgccgacgccggcgtcgtcgccgccgacctgatcagccaggccgagcacgacccg
ctggccgccgcggtgctggtcaccgactccgagcagctggcggaggaggtcgtgaaggag
ttggagacccgcgtcgccgcgaccaagcacgccgagcgtatccgcgaggccctggccgga
cgccagtcggcgctcgtcctcgtcgacgacatcggcgcggcgctggtcgtggccaacggc
tacgccgccgagcacctggagatccagacccggaacgccgccgccgacgccgccaaggtg
cgcaacgccggcgcggtcttcgtgggctccttcgcgccggtgagcctcggcgactatctc
gccggctccaaccacgtcctgccgaccggcggctgcgcctgccacagctccgggctgtcg
gtccagagcttcctgcgcgggatccacgtcgtggactacacgcgcgaagcgctggccgag
gcctccgacctggtcgtggcactggccaacgccgaggacctgcccgcccacggcgaggcc
gtgacggcgcgcttcgaagaacggcagggctga

DBGET integrated database retrieval system