KEGG   Catenulispora acidiphila: Caci_5908Help
Entry
Caci_5908         CDS       T00967                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cai  Catenulispora acidiphila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_5908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_5908
   00052 Galactose metabolism
    Caci_5908
   00500 Starch and sucrose metabolism
    Caci_5908
   00520 Amino sugar and nucleotide sugar metabolism
    Caci_5908
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caci_5908
   00524 Butirosin and neomycin biosynthesis
    Caci_5908
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Caci_5908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6815325..6816293)
Genome map
AA seq 322 aa AA seqDB search
MSAPEQSAEAADTVDDAAGPAYTLALDVGGTGIKAGLVTRDGTLRCTWRRATRIERGPEA
VIATIADFAAELVEAAAADGTPVAAAGFALPGIINEQTGVGVFSATVGWRDVPFGELLGA
RLAVPIAIGHDVRAGGVAEARIGAGRGSARFVFLPLGTSIGGAIMIDGVANLGPHGMGGE
FGHIVVRPGGLPCGCGLHGCLAQYSSAGAVAARYAEAAGTPNVGALDVAARLATGDPIAR
RIWDEAVDVLSDALLTTAALLDPDRVVVGGGLAEAGATLMTPLGEALAAKATYHALPELV
TAELGDLAGCLGAGLLAWDLVS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcccgagcagagcgccgaggcagctgacaccgttgacgacgctgccggtccg
gcgtacacgctcgccctggacgtcggcggcaccggtatcaaagcaggtctggtcacccgc
gacggcacgctgaggtgcacctggcgccgtgccacgcgtatcgagcgcggcccggaggcg
gtcatcgccacgatcgcggacttcgccgccgagctggtcgaggcggccgccgccgacggc
actccggtcgcggcagccggcttcgccctgcccgggatcatcaatgaacagaccggtgtc
ggggtgttctccgccaccgtcggttggcgggacgtgcctttcggcgagctgctcggcgcg
cgcctggcggtaccgatcgcgatcggccacgacgtgcgcgccgggggagtggccgaggcg
cgtatcggcgccggccgcggctcggcgcgcttcgtcttcctgccgctgggcaccagcatc
ggcggcgcgatcatgatcgacggcgtcgcgaacctgggcccgcacgggatgggcggggag
ttcgggcacatcgtcgtccgccccggcggtttgccctgcggctgcggtctgcacggctgc
ctggcgcagtactcctcggctggagccgtcgcggcgcgctacgccgaggccgccgggacg
ccgaacgtcggcgcgctggacgtcgcggcgcggctggcgaccggcgacccgatcgcccgg
cggatctgggatgaggcggtcgacgtcttgtccgacgctctgctcaccaccgctgcgctg
ctcgatcccgatcgggtggtcgtcggcgggggactggctgaggcaggcgcgacgttgatg
acgccgttgggcgaggcgttggcggcgaaggcgacgtatcacgcgctgccggagttggtc
accgccgaactcggcgatctggcgggctgcctgggcgccggactgctggcgtgggacctg
gtgtcgtga

DBGET integrated database retrieval system