KEGG   Catenulispora acidiphila: Caci_5961Help
Entry
Caci_5961         CDS       T00967                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
cai  Catenulispora acidiphila
Pathway
cai00984  Steroid degradation
cai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Caci_5961
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Caci_5961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 DAO TAT_signal GIDA Sec31
Motif
Other DBs
NCBI-ProteinID: ACU74819
JGI: Caci_5961
UniProt: C7QF61
Position
6880911..6882551
Genome map
AA seq 546 aa AA seqDB search
MSATSRHDPGARGLSRRGFLAGTGTVLGAAALGGLSASRASAAQRSTPISNGAHVQALII
GTGYGGSVAALRLAQAGIAVEMIEMGMAWDTPGSDGKIFCNLTSPDQRSFWLRTQTKQPV
GYFLGIPIDRAIPNYTGILDAEDFAGITVYQGRGIGGGSLVNGGMAVTPKQENFGAILPS
VNPAEMYNVYYPRANAGLGAGVVPQSWFTKTDWYQFARVGQKQAGRSGFPFQFVPDVYDW
NYMQQEDAGTVPKSALGQELLYGNNYGKKSLQKTYIPAALATGKVNISPLHKVTSVSPAS
GGGYTVLMNQLDTSGNVVVTKEVTADKVVFAAGSVGTSKLLVQMRDTGQLPHLNDQVGQG
WGDNGNIMVGRANQIWDPTGSKQSTVPCGGIDNWTKGGAFAEVAPLPIGIETWASLYLSI
TKNPHRAQFTWNAATQKVDLSWQLAWKQDGITMAKSIFDKINSTEGTIYRTDLFGSYKTW
QDQLTYHPLGGAVLNQATDNYGRLTAYPGLYVMDGALIPGNTSVNPFVTITALAERNIEN
IIANGG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaacatcaaggcacgacccaggagcccgaggtctgtcacggcgcggattcctg
gccggtacaggcacggttctgggcgcggcggccctcggcggcctgtcggcctcccgggcc
tccgccgcgcagcgcagcacccccatctccaacggagcccacgtccaggcgctgatcatc
ggcaccggatacggcggctcggtcgcggcgctgcggctggcccaggccggcatcgcggtg
gagatgatcgagatgggcatggcctgggacaccccggggtcggacgggaagatcttctgc
aacctgaccagtccggaccagcggtccttctggctgcggacgcagaccaagcagcccgtc
ggctacttcctcgggatcccgatcgaccgcgccatcccgaactacaccggcatcctcgac
gccgaggacttcgccgggatcacggtctaccaagggcgcggcatcggcggcgggtccctg
gtgaacggcggtatggcggtgacgccgaagcaggagaacttcggcgcgatcctgccctcg
gtgaaccccgccgagatgtacaacgtctactacccgcgcgccaacgccggtctcggcgcc
ggcgtcgtcccgcagagctggttcaccaaaaccgactggtaccagttcgcgcgcgtcggg
cagaagcaggccgggcggtccgggttcccgttccagttcgtgccggacgtgtacgactgg
aactacatgcagcaggaggacgccggcacggtcccgaagtcggcgctgggccaggaactg
ctctacggcaacaactacggcaagaagtccctgcagaagacgtacatcccggcggcgctg
gccaccggcaaggtgaacatctccccgctgcacaaggtgacctcggtgtccccggcctcc
ggcggcggctacacggtgctgatgaaccagctggacacctccgggaacgtggtcgtcacc
aaggaggtcaccgccgacaaggtggtcttcgccgcgggcagcgtgggcaccagcaagctg
ctggtccagatgcgcgacaccgggcagctgccgcacctgaacgaccaggtcgggcagggc
tggggcgacaacggcaacatcatggtcggccgggcgaaccagatctgggaccccaccggc
tccaaacagtccacggtcccgtgcggcggcatcgacaactggaccaagggcggcgcgttc
gccgaggtggcgccgctgccgatcgggatcgagacctgggcctcgctgtacctgtcgatc
acgaagaacccgcaccgcgcgcagttcacctggaacgccgccacgcagaaggtcgacctg
agctggcagctggcgtggaagcaggacggcatcacgatggccaagagcatcttcgacaag
atcaactccaccgagggcaccatctaccggaccgacctgttcggctcgtataagacctgg
caggaccagctgacgtaccacccgctgggcggcgcggtgctgaatcaggccacggacaac
tacggccggctgaccgcctatccgggcctgtacgtgatggacggcgcgctgatccccggc
aacaccagcgtgaacccgttcgtcaccatcaccgcgctggccgagcgcaacatcgagaac
atcatcgccaatggcggatga

DBGET integrated database retrieval system