KEGG   Catenulispora acidiphila: Caci_6026Help
Entry
Caci_6026         CDS       T00967                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cai  Catenulispora acidiphila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Caci_6026
Enzymes [BR:cai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Caci_6026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6945319..6947547
Genome map
AA seq 742 aa AA seqDB search
MAAPTTEPHGTLSVVEGVLERITFANEETGYTVARVDTGHGAADLLTVVGALLGAQPGES
LRMRGRWGSHPQYGKQFMVDNYTQVLPATVAGIQKYLGSGLIKGIGPKTAEKIVGHFGVD
TLTVIDETPARLIEVPTLGPKRTKLIAAAWIEQKAIKEVMVFLQSVGVTTSISVRIYKEY
GDASIDVVKQEPYKLASDVWGIGFKTADAIAVAVGIPHDSPERVKAGIQYALSQSSDAGN
CYLPREKLLEESVKILTVPTELTSHCLDELIEAEGVVAEDIPDPDGYDPDEPIRAIYLVP
FHRAEASLAAQLRRLLEAPDDRLASFATVDWDKALGWLKDRTGADLAPEQTAAVQQALTA
KVSVLTGGPGCGKSFTVRSIVELAQAKRARVVLAAPTGKAAKRLTELTGAEAMTVHRLLE
LKPGGDAAYDRDRPLEADLVVVDEASMLDVLLANKLVKAVAPGAHLLLVGDVDQLPSVGA
GEVLRDLLAAPRVPRVRLTQVFRQAQQSGVVVNAHRINSGKPLELKGFDDFFLFVEDETE
DAARVAVELATTRIPKRFGFDPRRDIQVLTPMHRGPAGAGTLNGLLQETLTPSQPSRPEK
RFGGRTFRVGDKVTQIRNNYDKGKNGVFNGTGGVITSMLLEEQTLVVHTDEDEEVTYEFA
ELDELQHAYAMTVHRSQGSEYPVVVVPVTMSAWMMLQRNLLYTAVTRAKKLVVLVGSKRA
LAQAIRTMSAGKRFTGLDYRLR
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcaccgaccaccgagccccacggcaccctgtcggtcgtcgagggcgtgctggag
cggatcaccttcgccaacgaggagaccggctacaccgtcgcgcgcgtcgacaccggccac
ggcgccgccgacctgctgacagtggtcggcgcgctgctcggcgcgcagcccggcgaatcg
ctgcggatgcgcggccgctggggctcgcatccgcagtacggcaagcagttcatggtcgac
aactacacgcaggtcctcccggcgaccgtcgcgggcatccagaagtacctgggctccgga
ctcatcaagggcatcggcccgaagaccgccgagaagatcgtcggccacttcggcgtggac
acactcacggtcatcgacgagacgccggcccgcctgatcgaggtcccgaccctgggaccg
aagcgcaccaagctcatcgcggcagcgtggatcgagcagaaggccatcaaagaggtcatg
gtcttcctgcagtcggtcggggtgaccacatcgatctcggtgcggatctacaaggagtac
ggcgacgcctcgatcgacgtcgtgaaacaggagccttacaagctcgcctcggacgtgtgg
ggcatcggcttcaagaccgccgacgcgatcgcggtggctgtcggcatcccgcacgactcg
ccggagcgcgtaaaggccggcatccagtacgcgctatcgcagagctctgacgctggtaac
tgctatctgccacgcgagaagctcctggaggagtctgtcaaaatcctgacggtccccacc
gagctcacctcccactgccttgatgaactcatcgaggcagagggagtcgtcgccgaggac
atcccggatcccgacggctacgaccccgacgagccgattcgcgccatctacctcgttccc
ttccaccgcgccgaagcctcgctggccgcccagctacggcgcctgctggaggcgccggac
gaccgcctcgcctcgttcgccacggtcgactgggacaaggctctgggctggctgaaggac
cgcaccggcgccgacctcgcgccggagcagaccgcggcggtgcagcaggcgctgacggcg
aaagtcagtgtcctgaccggcggcccgggctgcggcaagtcgttcacggtgcgctcgatc
gtggagttggcgcaggccaagcgggcgcgcgtggtcctggccgccccgaccggcaaggca
gccaagcgcctgaccgagctgaccggcgccgaggcgatgaccgtgcaccgcctgctggag
ctcaagccaggcggggacgccgcgtacgaccgggaccggccgctggaggccgacctcgtg
gtggtggacgaagcctcgatgctggacgtcctgctggcgaacaaactggtcaaggccgtc
gcccccggcgcacacctgttgctggtcggcgacgtggaccagctcccctccgtcggcgcc
ggcgaggtgctgcgcgatctcctagccgcgccccgagtgccccgcgtacgcctgacgcaa
gtcttccgccaggcgcaacagtccggcgtcgtggtgaacgcgcaccggatcaactcgggg
aaaccgttggagctcaagggattcgacgacttcttcctgttcgtcgaggacgagaccgag
gacgccgcacgcgtcgccgtcgagctggccacgacccgcatccccaaacgcttcggcttc
gacccccgccgcgacatccaggttctgactcccatgcaccgcggcccagccggcgccgga
accctcaatgggctcctgcaagaaacgctgaccccctcccagccctcgcgccccgagaag
cgcttcggcggccgcaccttccgcgtcggcgacaaggtcacgcagatccgcaacaactac
gacaagggaaagaacggcgtcttcaacggcaccggcggcgtcatcacctccatgctcctg
gaggagcagaccctggtggtacacaccgacgaggacgaagaggtgacgtatgagttcgcg
gagctggacgagctacagcacgcctacgccatgacagtgcaccgatcgcagggctctgaa
taccccgtagttgtggtccccgtgacaatgagcgcctggatgatgctgcaacgaaacctg
ctctacacggcagtcacgcgcgcgaagaagctggtggtcctggtcggctcgaaacgcgcc
ctggcacaagcgatccgcacgatgtccgcaggcaaacgcttcaccggcctggactaccgc
ctgcgatga

DBGET integrated database retrieval system