KEGG   Catenulispora acidiphila: Caci_6039Help
Entry
Caci_6039         CDS       T00967                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00860  Porphyrin and chlorophyll metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caci_6039
Enzymes [BR:cai01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Caci_6039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 VWA MCM AAA_16 VWA_3 Sigma54_activat AAA_29
Motif
Other DBs
NCBI-ProteinID: ACU74896
JGI: Caci_6039
UniProt: C7QGL6
Position
complement(6961014..6963173)
Genome map
AA seq 719 aa AA seqDB search
MPPYPFTAVVGLDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTIVRALAAVLPQIAVVPG
CRFSCDPAALDPACPDGPHAAGGTSGDAPGDTASETVGDPAAHSRPARLVELPVGATEDR
LVGSLDLEKVLASGVAAYEPGLLAAAHRGLLYVDEVNLLHDHLVDLLLDAAAMGVAHVER
EGVSVRHAARFLLVGTMNPEEGELRPQLLDRFGLTVEVRASRDPAERAEVVRRRLAYEAD
PEAFAAAWEQADKETAARIEAARALLPAVRLPDAELLRITRICAAFEVDGMRADLVTARA
ATALAAWAGRDEVTAEDVRQAAKLALPHRRRRHPFDAPGLDEERLDEAMDDGDQDPDPGP
GSGPSGTDSPENPDSATNPQTDSPARPDGSAADQTAPDAGPRGGQPEAADGESRSQRAAN
ATDATNSAHSADPAREHPPAAPSEPFKARLLQVEGVGTGAEGRRSRSRATGGRSVGARPG
SHGLHLVATVHASAPQQVARGRREGALRLRAEDLREPIREGREGNLVLFVVDASGSMAAR
QRMAAVKGAILSLLLDAYQRRDKVGLVTFRGREAEVALPPTWSVDAGAARLTSLPTGGRT
PLAAGLLQAADVLRVGRMRDPNRRPLVLVITDGRATQASHSKDPLADTWRAAAHLHQAVA
TLGGTSIVVDCEAGPVRLGLAARLAADLDADHLPLTDLAADTLTAAVHGNRPRSDRRAA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccgtacccgttcaccgccgtcgtcggtctcgacgacctgcggctggccctgctg
ctgaacgccgtgtctccggccgtcggcggcgtgctcgtgcgcggggagaagggcaccgcg
aaatcgacgatcgtgcgcgccctggctgccgtgctgccgcagatcgcggtcgtccccggc
tgccgcttctcctgcgacccggccgcgcttgaccccgcctgcccggacggcccgcatgcc
gcgggcggtacctcgggcgacgcccctggcgacaccgcgagcgaaaccgtcggcgaccca
gccgcccactcacgccccgcgcgcctggtcgagctgccggtcggcgcgaccgaggaccgc
ctcgtcggctccctggacctggagaaggtcctggcctccggcgtcgcggcctacgagccg
ggcctgctggccgccgcccaccgcggcctgctctacgtggacgaagtcaacctgctccac
gaccacctcgtggacctgctcctggacgccgccgcgatgggcgtcgcgcacgtcgagcgc
gaaggcgtctcggtccgccacgccgcccgcttcctgctggtcggcaccatgaaccccgaa
gaaggcgaactgcgcccgcagctgctggaccgcttcggtctcaccgtcgaggtgcgagcc
agccgcgacccggccgagcgcgccgaggtcgtccgccgccgcctggcctacgaggccgac
ccggaggccttcgccgccgcctgggagcaggccgacaaggagaccgccgcccgcatcgag
gcggcccgcgccctgctgcccgcggtgcggctgcccgatgccgaactgctgcgcatcacc
cgcatctgcgcggccttcgaggtcgacgggatgcgcgcggacctggtgacggcacgcgcc
gcgacggcgctcgcggcatgggccggacgcgacgaggtcaccgccgaggacgtgcgccag
gcggcgaagttggcgctgccgcaccgccggcgccgccatccgttcgacgcccccgggctg
gacgaggagcgcttggacgaggccatggacgacggggatcaggaccctgatcccggtcct
ggctctggccctagtggtacagacagtccggaaaaccctgacagcgccacaaatcctcaa
actgacagcccggcaagaccggatggctccgcggctgaccagaccgccccggatgccgga
ccgcgcggcgggcagccggaggcggctgacggcgaatcgcgctcgcagcgtgccgccaac
gcaaccgacgcaaccaactcagcccactccgccgaccccgcccgcgagcatccgcccgca
gccccgagcgaacccttcaaagcccgcctgctccaggtcgaaggcgtcggcaccggcgcc
gagggccgccgctcccgatcccgcgccaccggcggccgctccgtcggcgcccgccccggc
agccacggtctgcacctcgtcgcgaccgtccacgcctccgcgccccagcaggtcgcccga
ggccgccgcgaaggcgcgctgcgcctgcgcgccgaggacctgcgagagccgattcgcgag
ggccgcgaaggaaatctcgtcctgttcgtcgtcgacgcctccggctcgatggccgcccgc
cagcgcatggccgccgtcaagggcgcgatcctctcgctgctcctggacgcctatcagcgc
cgcgacaaggtcggcctggtgaccttccgcggccgcgaggccgaagtcgccctgccgccc
acctggtccgtcgacgccggcgccgcgcgactgacctcactgccgaccggcgggcgcacc
ccgctggccgccggtctgctgcaagccgccgacgtgctgcgtgtggggcgcatgcgcgac
ccgaaccggcgtccgctcgtgctggtcatcaccgacggccgagcgactcaggcctcgcat
tccaaggaccccctcgccgacacctggcgtgccgcggcccatctccaccaagcggtggcg
accctcggcggcacgtccatcgtcgtggactgcgaagccggcccggtccgcctgggcctg
gccgcgcgcctggcggccgacctggacgccgaccacctcccgctcaccgacctcgccgcg
gacacgctcaccgcggcggtgcacggcaaccgaccccgctccgaccggagggccgcctga

DBGET integrated database retrieval system