KEGG   Catenulispora acidiphila: Caci_6053Help
Entry
Caci_6053         CDS       T00967                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cai  Catenulispora acidiphila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_6053
   01230 Biosynthesis of amino acids
    Caci_6053
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_6053
   00030 Pentose phosphate pathway
    Caci_6053
   00051 Fructose and mannose metabolism
    Caci_6053
   00052 Galactose metabolism
    Caci_6053
  Energy metabolism
   00680 Methane metabolism
    Caci_6053
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Caci_6053
Protein phosphatases and associated proteins [BR:cai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Caci_6053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6975403..6976431)
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRASVRKGVQFYGFEFVGFRDGWKGPLDRMTKPLDVEAVRGI
LPRGGTILGSSRTNPLKVEGGVERIKENLAAEGVDALIAIGGEDTLGVATVLGDEYGVNV
VGVPKTIDNDLNATDYTFGFDTAVHVATEAIDRLHTTAESHSRALIVEVMGRHAGWIALH
SGLAGGANVILIPEVTFDIDEVCGWIESRFARGYAPIVVVAEGATPKDGQMEVSSGELDA
FGHVRLGGIGERLADEIERRTKKEARTTVLGHTQRGGTPSPFDRWLATRFGLHAIDAVHD
GDFGKMVALRGTDIVRVPLAAATATLKTVPMSLYEEAKVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagtgctgaccggcggcggggactgcccgggactgaacgcggtgatccgc
gcctcggtccgcaagggagtgcagttctacggctttgagttcgtcggttttcgggacggc
tggaagggccccctggaccggatgaccaagccgttggacgtcgaggcggtgcgcggcatc
ctgccccgcggcggcaccatcctcggatcctcgcgcaccaatccgttgaaggtggagggc
ggcgtcgagcggatcaaggagaacctggcagccgagggcgtggacgccctgatcgccatc
ggcggcgaggacaccctcggcgtcgcgaccgtgctcggcgacgagtacggcgtcaacgtc
gtcggcgtgcccaagaccatcgacaacgacctcaacgccaccgactacaccttcggcttc
gacaccgcggtccacgtcgccaccgaggcgatcgaccgtctgcacaccaccgccgagtcc
cactccagggcgctgatcgtggaggtgatgggccgccacgccggctggatcgccctgcac
tcgggcctggccggcggcgccaacgtgatcctgatccccgaggtcaccttcgacatcgac
gaggtctgcggctggatcgaatcccgcttcgcccgcggctacgccccgatcgtggtggtc
gccgagggcgcgacccccaaggacggccagatggaggtctcctccggcgaactcgacgcc
ttcggccacgtccgcctcggcggcatcggcgaacgcctcgccgacgagatcgagcgccgc
accaagaaggaagcccgcaccaccgtcctgggccacacccagcgcggcggcaccccctcg
cccttcgaccgctggctcgccacccgcttcggcctccacgccatcgacgccgtccacgac
ggcgacttcggcaagatggtcgccctgcgcggcaccgacatcgtgcgcgtgccgctcgcg
gccgccacggcgacgctgaagacggtgccgatgtcgctgtatgaggaggcgaaggtcttc
ttcggctaa

DBGET integrated database retrieval system