KEGG   Catenulispora acidiphila: Caci_6060Help
Entry
Caci_6060         CDS       T00967                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cai  Catenulispora acidiphila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6982323..6983120
Genome map
AA seq 265 aa AA seqDB search
MTAPVLPGAEPFSHDVPAAAEAAEGAGPARIGVLLCHGFTGSPQSLRPWAEHLAEAGFGV
RLPRLPGHGTDWHDMQVTTWDDWYAEVDRAFHELQAGYDRVFVMGLSMGGTLTLRLAERH
GADVAGIVLVNASVKPDKAVIKLVPVLKLLVPSVAGIGNAINKQGVSELAYSRVPLKALD
SFAGGWRTVAADLPKVTQPTLLFRSTADPVVHPSNSAMILSRISATDVTEQVLEKSSHVA
TLDHDAEQIYAGSVEFVRRVAGLGN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcccgtgctccccggtgccgaacccttctcgcacgacgtgcccgccgcggcc
gaggccgccgaaggcgcaggtccggcccggatcggcgtcctgctgtgccacggattcacc
ggctccccgcagtccctgcggccctgggccgagcaccttgccgaggccgggttcggggtg
cggctgccgcggctgcccgggcacgggaccgactggcacgacatgcaggtcaccacctgg
gacgactggtacgccgaggtggaccgcgccttccacgagctgcaggccggctacgaccgg
gtgttcgtcatgggcctgtcgatgggcggcacgctcaccttgcgcctggccgagcggcac
ggcgccgacgtggccggcatcgtgctggtcaacgcctcggtgaagccggacaaggcggtc
atcaagctggtcccggtactcaagctcctggtcccgagcgtggccgggatcggcaacgcg
atcaacaagcagggtgtcagcgaactggcttacagccgggtgccgctcaaggccctggac
tccttcgccggcggctggcgcaccgtggcggcggacctgccgaaggtcacgcagcccacc
ctgctgttccggtccaccgcggacccggtggtccacccgtcgaacagcgccatgatcttg
tcccgcatctcggccaccgacgtgaccgaacaggtgctggagaagagctcgcacgtggcc
accctggaccacgacgccgagcagatctatgccggaagcgtggaattcgtccggcgggtc
gccgggttggggaattga

DBGET integrated database retrieval system