KEGG   Catenulispora acidiphila: Caci_6060Help
Entry
Caci_6060         CDS       T00967                                 

Definition
(GenBank) esterase/lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
cai  Catenulispora acidiphila
Brite
Enzymes [BR:cai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Caci_6060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Ser_hydrolase Abhydrolase_5 DLH UPF0227 Abhydrolase_3 Thioesterase Abhydrolase_2 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ACU74917
JGI: Caci_6060
UniProt: C7QGN7
Position
6982323..6983120
Genome map
AA seq 265 aa AA seqDB search
MTAPVLPGAEPFSHDVPAAAEAAEGAGPARIGVLLCHGFTGSPQSLRPWAEHLAEAGFGV
RLPRLPGHGTDWHDMQVTTWDDWYAEVDRAFHELQAGYDRVFVMGLSMGGTLTLRLAERH
GADVAGIVLVNASVKPDKAVIKLVPVLKLLVPSVAGIGNAINKQGVSELAYSRVPLKALD
SFAGGWRTVAADLPKVTQPTLLFRSTADPVVHPSNSAMILSRISATDVTEQVLEKSSHVA
TLDHDAEQIYAGSVEFVRRVAGLGN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcccgtgctccccggtgccgaacccttctcgcacgacgtgcccgccgcggcc
gaggccgccgaaggcgcaggtccggcccggatcggcgtcctgctgtgccacggattcacc
ggctccccgcagtccctgcggccctgggccgagcaccttgccgaggccgggttcggggtg
cggctgccgcggctgcccgggcacgggaccgactggcacgacatgcaggtcaccacctgg
gacgactggtacgccgaggtggaccgcgccttccacgagctgcaggccggctacgaccgg
gtgttcgtcatgggcctgtcgatgggcggcacgctcaccttgcgcctggccgagcggcac
ggcgccgacgtggccggcatcgtgctggtcaacgcctcggtgaagccggacaaggcggtc
atcaagctggtcccggtactcaagctcctggtcccgagcgtggccgggatcggcaacgcg
atcaacaagcagggtgtcagcgaactggcttacagccgggtgccgctcaaggccctggac
tccttcgccggcggctggcgcaccgtggcggcggacctgccgaaggtcacgcagcccacc
ctgctgttccggtccaccgcggacccggtggtccacccgtcgaacagcgccatgatcttg
tcccgcatctcggccaccgacgtgaccgaacaggtgctggagaagagctcgcacgtggcc
accctggaccacgacgccgagcagatctatgccggaagcgtggaattcgtccggcgggtc
gccgggttggggaattga

DBGET integrated database retrieval system