KEGG   Catenulispora acidiphila: Caci_6127Help
Entry
Caci_6127         CDS       T00967                                 

Definition
cobalamin biosynthesis protein CobD
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
cai  Catenulispora acidiphila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cai00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7052426..7053370)
Genome map
AA seq 314 aa AA seqDB search
MRSSARVVGLAVGFVADWCFGDPGRGHPVAGFGRVASGVRGVLYADSRGAGVAYAGVLVA
GAGVVGVAAEWVGRGRPVVGAALTAAATWTVLGGTSLRREASAIGESLGGGDLAAARERL
PHLCGRDPRGLDADQIARAVVESVAENTSDAVVAPLFWGAVAGIPGLLAYRASNTLDAMV
GYRNAKYRNFGWASARLDDVLNWVPARFTGVVTVAAAPVVGGSPVRALRVLRRDGARHPS
PNAGRCEASAAGALGVRLGGTNTYGDAVEHRPVMGTGRAPRVADIRRAAVLSATVGLASA
VAAARLAGALARSR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcttcggcgcgggtggtggggttggcggtggggtttgtggctgattggtgcttt
ggggatccggggcgggggcatccggtggcggggtttgggcgggtggcttcgggggtgcgg
ggggttttgtatgcggattcgcggggtgcgggggtggcttatgccggggtgcttgttgcg
ggggcgggggtggtgggggttgcggctgagtgggtcgggcgggggcggccggtggttggt
gctgctttgactgctgcggctacgtggactgtgctgggtgggacttcgttgcggcgtgag
gcttctgctatcggggagtcgttgggtggcggtgatcttgcggcggcgagggagcggttg
ccgcatctgtgtgggcgggatccgcgggggttggatgccgatcagattgcgcgggcggtg
gtggagtcggtggctgagaacacctctgatgccgtggtggcgccgttgttctggggtgcg
gtggcggggattccggggctgctggcgtatcgggcgtccaacacgctggatgcgatggtc
ggctaccgcaatgccaagtaccggaacttcgggtgggcctcggcgcgcctcgatgatgtc
ctcaactgggttcccgcacgcttcaccggtgtcgtcaccgtagctgcggcgccggttgtc
ggcggcagcccggtgcgggcgctcagggttctgcgacgtgatggcgcccggcatccaagt
ccgaatgcgggacgctgcgaagcctccgccgccggtgccctgggcgtgcgcctcggcggt
accaacacctatggcgacgccgtcgagcatcgtcctgtcatggggaccggtcgtgcgccg
cgcgtggcggacattcgtcgggccgcggtgttgtcggcgacggtcgggctcgcctcggcg
gtcgcggccgcacgcttggcgggagccctcgcgcgatcacggtag

DBGET integrated database retrieval system