KEGG   Catenulispora acidiphila: Caci_6127Help
Entry
Caci_6127         CDS       T00967                                 

Definition
(GenBank) cobalamin biosynthesis protein CobD
  KO
K02227  adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
cai  Catenulispora acidiphila
Pathway
cai00860  Porphyrin and chlorophyll metabolism
cai01100  Metabolic pathways
Module
cai_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caci_6127
Enzymes [BR:cai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     Caci_6127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobD_Cbib AmpE
Motif
Other DBs
NCBI-ProteinID: ACU74981
JGI: Caci_6127
UniProt: C7QIA4
Position
complement(7052426..7053370)
Genome map
AA seq 314 aa AA seqDB search
MRSSARVVGLAVGFVADWCFGDPGRGHPVAGFGRVASGVRGVLYADSRGAGVAYAGVLVA
GAGVVGVAAEWVGRGRPVVGAALTAAATWTVLGGTSLRREASAIGESLGGGDLAAARERL
PHLCGRDPRGLDADQIARAVVESVAENTSDAVVAPLFWGAVAGIPGLLAYRASNTLDAMV
GYRNAKYRNFGWASARLDDVLNWVPARFTGVVTVAAAPVVGGSPVRALRVLRRDGARHPS
PNAGRCEASAAGALGVRLGGTNTYGDAVEHRPVMGTGRAPRVADIRRAAVLSATVGLASA
VAAARLAGALARSR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcttcggcgcgggtggtggggttggcggtggggtttgtggctgattggtgcttt
ggggatccggggcgggggcatccggtggcggggtttgggcgggtggcttcgggggtgcgg
ggggttttgtatgcggattcgcggggtgcgggggtggcttatgccggggtgcttgttgcg
ggggcgggggtggtgggggttgcggctgagtgggtcgggcgggggcggccggtggttggt
gctgctttgactgctgcggctacgtggactgtgctgggtgggacttcgttgcggcgtgag
gcttctgctatcggggagtcgttgggtggcggtgatcttgcggcggcgagggagcggttg
ccgcatctgtgtgggcgggatccgcgggggttggatgccgatcagattgcgcgggcggtg
gtggagtcggtggctgagaacacctctgatgccgtggtggcgccgttgttctggggtgcg
gtggcggggattccggggctgctggcgtatcgggcgtccaacacgctggatgcgatggtc
ggctaccgcaatgccaagtaccggaacttcgggtgggcctcggcgcgcctcgatgatgtc
ctcaactgggttcccgcacgcttcaccggtgtcgtcaccgtagctgcggcgccggttgtc
ggcggcagcccggtgcgggcgctcagggttctgcgacgtgatggcgcccggcatccaagt
ccgaatgcgggacgctgcgaagcctccgccgccggtgccctgggcgtgcgcctcggcggt
accaacacctatggcgacgccgtcgagcatcgtcctgtcatggggaccggtcgtgcgccg
cgcgtggcggacattcgtcgggccgcggtgttgtcggcgacggtcgggctcgcctcggcg
gtcgcggccgcacgcttggcgggagccctcgcgcgatcacggtag

DBGET integrated database retrieval system