KEGG   Catenulispora acidiphila: Caci_6169Help
Entry
Caci_6169         CDS       T00967                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cai  Catenulispora acidiphila
Pathway
cai00010  Glycolysis / Gluconeogenesis
cai00020  Citrate cycle (TCA cycle)
cai00620  Pyruvate metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01200  Carbon metabolism
Module
cai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_6169
   00020 Citrate cycle (TCA cycle)
    Caci_6169
   00620 Pyruvate metabolism
    Caci_6169
Enzymes [BR:cai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Caci_6169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU75023
JGI: Caci_6169
UniProt: C7QIE6
Position
complement(7098563..7100353)
Genome map
AA seq 596 aa AA seqDB search
MGGPVTARVFLLPDLGEGLTEAEIIAWHVTVGEHVSVDQVVCEVETAKASVEVPCPYAGE
VVELHGAVGDVVDVGKPLISIAAAVVAAAGGGAGGAGSSDNRPQGLKAAPEEPADRARLD
AAARNGAKIGSGGSAGSGSGSGSGNVLVGYGTAESGGVRRRRVVSGFGGHGGSPRVHGAP
VAGSGDGGAVSNGAAGSSDAEGNGSAGAGAASSGATSGAEGHGSAHGTGAAGSGSMGSGA
ARDGSADSAAARHVSADSAAARNGSAGSAAARNGSAGGGSASSPSAAKAVPALSGAAVQE
RSGAAPRIAVVSPLVRRLAKEGGLDLASVQGTGPEGLIMRRDVEAALAAPAAAPASLALS
SSAGIAELERVPLRGLRKTVAEKLSRSRREIPDATTWVDVDATGLMELRAALNRDASARK
ISLLAVLARICVAGLARYPELNATVDVEQQEIVRYADVNLGFAAQTDRGLVVPVVHGAHR
MSTEELAAEFERLTAAARAGSLPLSDLTGSTFTLNNYGVYGVDGSTPILNHPEAAMLGVG
RIVKKPWVVADELAIRQVTQLSFTFDHRVCDGGVAGGFLRYVADLVEEPARLLRSL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtgggaggaccggtgacggcccgcgtattcctgctcccggacctcggggaaggactgacc
gaggccgagatcatcgcctggcacgtcacggtgggcgagcacgtctccgtcgaccaggtg
gtctgcgaggtcgagacggcgaaggcgtcggtcgaggtgccgtgtccttacgccggcgag
gtcgttgaactgcacggggcggtcggcgacgtcgtcgacgtcggcaagccgctgatcagc
atcgcggcggcggtggttgcggcggctggtggtggtgctggtggtgctggtagctcagat
aacaggccccaaggattgaaggcggcgcctgaggagccggcggatcgggctcggcttgat
gctgcggctcggaacggggcgaagatcggctccggtggtagcgctggcagcggctcaggg
agcggctccggcaatgtgctggtggggtacgggaccgccgagagcggaggggtccggcga
cggcgcgtggtgagcgggttcggtgggcacggcggctcgcctcgggtgcatggcgcgccg
gttgccgggtcgggcgatggcggcgcggtgagtaatggtgctgcgggcagtagcgatgct
gagggcaatggctcggcgggtgctggtgctgcgagcagcggtgcgactagtggtgctgag
ggccatggctccgcgcatggcactggtgctgcgggcagtggctcgatgggcagcggtgcg
gctcgcgatggttcagcggacagtgctgcggctcgccacgtttcagcggacagtgctgcg
gctcgtaatggttcagcaggcagtgctgcggctcgcaacggttcagcgggcggtggctcc
gcatcatctccgagtgctgcgaaggccgtgcccgcgctgagcggtgcggctgtgcaggag
cgctctggtgcggcgcctcgaattgcggtcgtgtctcctctcgtgcgtcggctggcgaag
gagggtgggctcgacctggcttccgtgcaggggaccgggcctgagggcttgatcatgcgg
cgggatgtcgaggcggcgcttgctgcaccggctgctgctcctgcgtcgctggcgctgagt
tcgagtgctggtatcgccgagctcgagcgcgtgccgttgcgtggtctgcgcaagacggtc
gcggagaagctttctcgctctcggcgtgagatcccggatgcgacgacgtgggtcgatgtc
gatgcgaccggcctcatggagctgcgtgcggcgctgaacagggacgcgtcggcgcgcaag
atcagtctgctggcggtgttggcgcggatctgtgtggcgggtctggcgcggtatccggag
ctgaacgcgacggtggatgtggagcagcaggagatcgtccgctacgccgacgtgaacctc
ggctttgcggcgcagacagatcgcggcttggtcgtacctgtcgtccatggtgcgcaccgg
atgtcgaccgaggagctggcggccgagttcgagcggctgaccgctgcggctcgcgccggc
tcgctgccgctgtccgacctgaccggctcgaccttcaccctgaacaactacggcgtctac
ggcgtcgacggctccaccccgatcctgaaccaccccgaggcggcgatgctcggcgtgggg
cgcatcgtgaagaagccgtgggtggtcgccgacgagctggcgatccgccaggtcacgcag
ctgtcgttcaccttcgaccaccgcgtgtgcgacggcggcgtggccggcggcttcctacgc
tacgtcgcagacctggtcgaggagcccgcacggttgttgcggagtctgtaa

DBGET integrated database retrieval system