KEGG   Catenulispora acidiphila: Caci_6198Help
Entry
Caci_6198         CDS       T00967                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cai  Catenulispora acidiphila
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Caci_6198
Enzymes [BR:cai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Caci_6198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7133131..7135533
Genome map
AA seq 800 aa AA seqDB search
MTRLSRQSPRKSPLSAKDLDAVNAYWRAANYLSVGQIYLLDNPLMRRPLSLDDVKPRLLG
HWGTTPGLNFIYAHMNRVIKARDLDAIYVAGPGHGGPGVLANVYLEGTYSEIYPGIGQDE
DGMRKLFRQFSFPGGVPSHVAPETPGSIHEGGELGYSLAHAYGAAFDNPDLLVCAVVGDG
EAETGPLAASWHSNKFVNPVRDGTVLPILHLNGYKIANPTVLSRIPQAELEQLMRGYGYE
PFTVVSEEGADPLEAHQAMAATLDAMLDRIADIRTRALTGRDNGERPAWPMLILRTPKGW
TGPKTVDGKRTEDSWRSHQVPMANVHTNPAHLKVLEEWMRSYRPEELFDPAGALMPELAA
LAPSGLRRMGANPHANGGVLLRDLKMPDFRDYAVEPAGHGVEHAESTKILGTFLRDIMSD
NSGADNFRVFGPDETASNRLQALFEATGRMWNAETVPWDDEHLALDGRVLEPLSEHMCQG
WLEGYLLTGRHGFFSCYEAFIHIVDSMFNQHAKWLKTTRHIPWRAPIASLNYLLTSHVWR
QDHNGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLLSVADHCLRSRDYVNVIVAGKQPQ
LQYLSMEEAIVHCTRGIGIWEWASSDGDGEPDLVMGCAGDVPTMETLAAVDILRQNFPDL
KVRVVNVVDLMRLQGSDEHPHGLSDKEFDALFTTAKPVVFTYHGYPWLIHRLTYRRTNHG
NLHVRGYKEEGTTTTPFDMAMLNDIDRYHLAIDAIDRVPGLAERAGHLRQQLLDARLKAR
QYTREFGEDDPAISGWAWPY
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgcctctctcgacaatcaccgcgcaagagcccgctgtccgccaaggacctcgac
gccgtcaacgcctattggcgtgccgccaactacctgtcggtgggtcagatctacctgctg
gacaatccgctgatgcgccggccgctgagcctggacgacgtcaagccgcggctgctgggc
cactggggcaccacgccggggctgaacttcatctacgcgcacatgaaccgggtcatcaag
gcgcgggatctggacgcgatctacgtcgccggtcccgggcacggcggtcccggcgtgctg
gcgaacgtctatctggaaggcacgtacagcgagatctacccggggatcggccaggacgag
gacgggatgcgcaagctgttccgccagttctccttccccggcggtgtgccctcgcacgtc
gcgccggagacgccgggctcgatccacgagggcggcgagctgggctattccctggcgcac
gcctacggcgcggcgttcgataacccggacctgctggtgtgcgcggtggtcggcgacggc
gaggcggagaccgggccgctggccgcgtcgtggcactcgaacaagttcgtcaacccggtg
cgcgacggcacggtgctgccgatcctgcacctgaacggctacaagatcgccaacccgacc
gtgctgtcccgcatcccgcaggccgagctggagcaactgatgcgcgggtacggctacgag
ccgttcacggtcgtcagcgaggagggcgccgatccgctggaggcgcaccaggcgatggcc
gccacgctggacgcgatgctggaccggatcgccgacatccggacgcgcgcgctcaccggc
cgagacaacggcgagcgcccggcgtggccgatgctgatcctgcgcacgccgaagggctgg
accggcccgaagaccgtcgacggcaagcgcacggaggactcctggcgctcgcaccaggtg
ccgatggccaacgtgcacaccaacccggcgcatctgaaggtgctggaggagtggatgcgc
tcctaccgcccggaggagctgttcgacccggccggtgcgctgatgccggagttggcggcg
ctggcgccgtccgggctgcggcggatgggggcgaacccgcacgccaacggcggtgtgctg
ctgcgggatctgaagatgccggacttccgcgactacgcggtcgagccggccgggcacggc
gtcgagcacgcggagtccacgaagatcctcggcacgttcctgcgcgacatcatgagcgac
aattcgggtgctgacaacttccgggtcttcgggcccgacgagacggcgtccaaccggctg
caggcgttgttcgaggcgacgggccggatgtggaacgccgagacggtgccgtgggacgac
gagcacctggcgctggacggccgggtgctggagccgctgagcgagcacatgtgccagggc
tggctggagggctatctgctgaccgggcggcacgggttcttctcgtgctacgaggcgttc
atccacatcgtggactcgatgttcaaccagcacgcgaagtggctgaagacgacccggcac
atcccctggcgggcgccgatcgcctcgctgaactacctgctgacctcgcacgtatggcgg
caggaccacaacggcttctcgcaccaggacccgggcttcatcgaccacgtcgtgaacaag
aaggcggacgtgatccgcgtgtacctgccgccggacgcgaacacgctgctgtcggtggcg
gaccactgcctgcgctcgcgggactacgtgaacgtcatcgtcgcgggcaagcagccgcaa
ctccagtacctgtcgatggaagaagcgatcgtgcactgcacgcgcggcatcggcatctgg
gagtgggcctccagcgacggcgacggcgagccggacctggtgatgggctgcgccggcgac
gtcccgacgatggagaccctggccgccgtggacatcctgcgccagaacttcccagacctg
aaggtccgcgtggtgaacgtcgtggacctcatgcgcctgcagggcagcgacgaacacccg
cacggcctgtccgacaaggaattcgacgccctgttcaccaccgccaagccagtggtcttc
acctaccacggctacccctggctcatccaccgcctgacctaccgccgcaccaaccacggc
aacctccacgtccgcggctacaaggaggaaggcaccaccaccacccccttcgacatggcc
atgctgaacgacatcgaccgctaccacctagccatcgacgccatcgaccgcgtccccggc
ctcgccgaacgcgccggccacctccgccagcaactcctggacgcacgcctgaaggcacgc
cagtacacccgcgagttcggcgaggacgacccggcgatttcggggtgggcgtggccttac
tga

DBGET integrated database retrieval system