KEGG   Catenulispora acidiphila: Caci_6198Help
Entry
Caci_6198         CDS       T00967                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
cai  Catenulispora acidiphila
Pathway
cai00030  Pentose phosphate pathway
cai01100  Metabolic pathways
cai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Caci_6198
Enzymes [BR:cai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Caci_6198
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Caci_6198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACU75052
JGI: Caci_6198
UniProt: C7QIH5
Position
7133131..7135533
Genome map
AA seq 800 aa AA seqDB search
MTRLSRQSPRKSPLSAKDLDAVNAYWRAANYLSVGQIYLLDNPLMRRPLSLDDVKPRLLG
HWGTTPGLNFIYAHMNRVIKARDLDAIYVAGPGHGGPGVLANVYLEGTYSEIYPGIGQDE
DGMRKLFRQFSFPGGVPSHVAPETPGSIHEGGELGYSLAHAYGAAFDNPDLLVCAVVGDG
EAETGPLAASWHSNKFVNPVRDGTVLPILHLNGYKIANPTVLSRIPQAELEQLMRGYGYE
PFTVVSEEGADPLEAHQAMAATLDAMLDRIADIRTRALTGRDNGERPAWPMLILRTPKGW
TGPKTVDGKRTEDSWRSHQVPMANVHTNPAHLKVLEEWMRSYRPEELFDPAGALMPELAA
LAPSGLRRMGANPHANGGVLLRDLKMPDFRDYAVEPAGHGVEHAESTKILGTFLRDIMSD
NSGADNFRVFGPDETASNRLQALFEATGRMWNAETVPWDDEHLALDGRVLEPLSEHMCQG
WLEGYLLTGRHGFFSCYEAFIHIVDSMFNQHAKWLKTTRHIPWRAPIASLNYLLTSHVWR
QDHNGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLLSVADHCLRSRDYVNVIVAGKQPQ
LQYLSMEEAIVHCTRGIGIWEWASSDGDGEPDLVMGCAGDVPTMETLAAVDILRQNFPDL
KVRVVNVVDLMRLQGSDEHPHGLSDKEFDALFTTAKPVVFTYHGYPWLIHRLTYRRTNHG
NLHVRGYKEEGTTTTPFDMAMLNDIDRYHLAIDAIDRVPGLAERAGHLRQQLLDARLKAR
QYTREFGEDDPAISGWAWPY
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgcctctctcgacaatcaccgcgcaagagcccgctgtccgccaaggacctcgac
gccgtcaacgcctattggcgtgccgccaactacctgtcggtgggtcagatctacctgctg
gacaatccgctgatgcgccggccgctgagcctggacgacgtcaagccgcggctgctgggc
cactggggcaccacgccggggctgaacttcatctacgcgcacatgaaccgggtcatcaag
gcgcgggatctggacgcgatctacgtcgccggtcccgggcacggcggtcccggcgtgctg
gcgaacgtctatctggaaggcacgtacagcgagatctacccggggatcggccaggacgag
gacgggatgcgcaagctgttccgccagttctccttccccggcggtgtgccctcgcacgtc
gcgccggagacgccgggctcgatccacgagggcggcgagctgggctattccctggcgcac
gcctacggcgcggcgttcgataacccggacctgctggtgtgcgcggtggtcggcgacggc
gaggcggagaccgggccgctggccgcgtcgtggcactcgaacaagttcgtcaacccggtg
cgcgacggcacggtgctgccgatcctgcacctgaacggctacaagatcgccaacccgacc
gtgctgtcccgcatcccgcaggccgagctggagcaactgatgcgcgggtacggctacgag
ccgttcacggtcgtcagcgaggagggcgccgatccgctggaggcgcaccaggcgatggcc
gccacgctggacgcgatgctggaccggatcgccgacatccggacgcgcgcgctcaccggc
cgagacaacggcgagcgcccggcgtggccgatgctgatcctgcgcacgccgaagggctgg
accggcccgaagaccgtcgacggcaagcgcacggaggactcctggcgctcgcaccaggtg
ccgatggccaacgtgcacaccaacccggcgcatctgaaggtgctggaggagtggatgcgc
tcctaccgcccggaggagctgttcgacccggccggtgcgctgatgccggagttggcggcg
ctggcgccgtccgggctgcggcggatgggggcgaacccgcacgccaacggcggtgtgctg
ctgcgggatctgaagatgccggacttccgcgactacgcggtcgagccggccgggcacggc
gtcgagcacgcggagtccacgaagatcctcggcacgttcctgcgcgacatcatgagcgac
aattcgggtgctgacaacttccgggtcttcgggcccgacgagacggcgtccaaccggctg
caggcgttgttcgaggcgacgggccggatgtggaacgccgagacggtgccgtgggacgac
gagcacctggcgctggacggccgggtgctggagccgctgagcgagcacatgtgccagggc
tggctggagggctatctgctgaccgggcggcacgggttcttctcgtgctacgaggcgttc
atccacatcgtggactcgatgttcaaccagcacgcgaagtggctgaagacgacccggcac
atcccctggcgggcgccgatcgcctcgctgaactacctgctgacctcgcacgtatggcgg
caggaccacaacggcttctcgcaccaggacccgggcttcatcgaccacgtcgtgaacaag
aaggcggacgtgatccgcgtgtacctgccgccggacgcgaacacgctgctgtcggtggcg
gaccactgcctgcgctcgcgggactacgtgaacgtcatcgtcgcgggcaagcagccgcaa
ctccagtacctgtcgatggaagaagcgatcgtgcactgcacgcgcggcatcggcatctgg
gagtgggcctccagcgacggcgacggcgagccggacctggtgatgggctgcgccggcgac
gtcccgacgatggagaccctggccgccgtggacatcctgcgccagaacttcccagacctg
aaggtccgcgtggtgaacgtcgtggacctcatgcgcctgcagggcagcgacgaacacccg
cacggcctgtccgacaaggaattcgacgccctgttcaccaccgccaagccagtggtcttc
acctaccacggctacccctggctcatccaccgcctgacctaccgccgcaccaaccacggc
aacctccacgtccgcggctacaaggaggaaggcaccaccaccacccccttcgacatggcc
atgctgaacgacatcgaccgctaccacctagccatcgacgccatcgaccgcgtccccggc
ctcgccgaacgcgccggccacctccgccagcaactcctggacgcacgcctgaaggcacgc
cagtacacccgcgagttcggcgaggacgacccggcgatttcggggtgggcgtggccttac
tga

DBGET integrated database retrieval system