KEGG   Catenulispora acidiphila: Caci_6417Help
Entry
Caci_6417         CDS       T00967                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cai  Catenulispora acidiphila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caci_6417
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_6417
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caci_6417
Enzymes [BR:cai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caci_6417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7407019..7408167
Genome map
AA seq 382 aa AA seqDB search
MNPLASLSLHCPACDNRYALHDLAWRCTDCHGVLELSGFAPTFPSPADLSHRPPTLWRYA
EALPLAEPTAITLGEGMTPLVTAPGRSDVRLKVDYLMPTGSFKDRGAVLLAALADKLSAG
RMVADSSGNAGTAIAAYAARAGIPCEVYVPQSTSAGKVAQLRAYGAAVHQIPGSREDTAD
AAAEAADVPGTLYASHVYNPFFFHGTKTYVFELWEQLGGRLPHTLVLPVGNGTLVLGAHL
GSRELLAAGLIDRLPRIVAVQAATCAPLATAFQAGHAEPAQITPEPTLAEGIAIARPARG
AQILAAIRATGGVITTVTDAQVSASHAALARAGLYVEPTGAACWAALSAGLVAEPETPRD
PAVPFAVAPLCGSGLKSKPPHS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccctctggcgtcgctgtccctccactgccccgcctgcgacaaccgctacgccctc
cacgacctggcctggcgctgcaccgactgccacggcgtcctggaactgtccggcttcgcc
cccacgttcccctcaccggccgacctatcccaccgcccgccgaccctgtggcgctacgcc
gaggccctcccactcgccgagcccaccgccatcaccctcggcgagggcatgacgccgctg
gtcacggcaccgggccgctcggacgtccgcctcaaggtcgactacctgatgccgaccggc
tcgttcaaggaccgcggcgccgtcctgctcgccgccctcgccgacaagctgtccgccggc
cgcatggtcgccgacagcagcggcaacgccggcacggccatcgccgcctacgccgctcgc
gccggcatcccctgcgaggtctacgtcccgcaatccacctcagccggcaaggtcgcccaa
ctccgcgcctacggcgccgccgtccaccagatccccggctcccgcgaggacaccgccgac
gccgcagccgaggcggcggacgtccccggcaccctctacgccagccacgtctacaacccc
ttcttcttccacggcaccaagacctatgtcttcgagctctgggaacaactaggcggacgc
ctcccgcacaccctggtcctcccggtcggcaacggcaccctcgtcctcggcgcccacctc
ggaagccgcgaactcctcgccgcaggcctgatcgaccgcctgccccgcatcgtcgccgtc
caagccgccacctgcgcacccctggccacagccttccaagccggccacgccgaacccgcg
cagatcacccccgaaccaaccctcgccgaaggcatcgccatcgcccgcccagcccgcggc
gcccaaatcctcgccgcgatccgcgccaccggcggcgtcatcaccacggtcaccgacgcg
caggtcagcgcgtcgcacgcagcgctagcccgcgccggcttgtacgtagaaccgaccggc
gcagcctgttgggcagctctcagtgcaggactcgtcgcggagcccgaaacgccacgagac
ccggctgtgccattcgcagtagcccccctgtgtggcagcggcctgaaatcaaagccccca
cactcctga

DBGET integrated database retrieval system