KEGG   Catenulispora acidiphila: Caci_6555Help
Entry
Caci_6555         CDS       T00967                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cai  Catenulispora acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cai00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7547701..7549164)
Genome map
AA seq 487 aa AA seqDB search
MFPDFSSPGSARRRGFSAVAATVAAVAGLVVATQLGGVAMAGTIASGTQFYADPNSQVVK
WDAANPGDAREPAIASQIASVSQGIWFSNYRPSTVQSDVSAVTTAAAAAGKTPVLVVYEI
PNRDCGGASAGGAPDISSYENYIQSFANGLGSHQVIVILEPDSLALQTCLSSQQATDRDN
AIAFAGAHLKSADPAAKVYLDAGHSSWNSPSAQAAALNAAGVKTSSDGIFSNVSNFQTTA
SEVSYDKQVLAALGSPSNLHIVVDTSRNGNGPAGSAWCDPSGRALGQAPTANTGDAAVDA
FLWIKPPGEADGCADAAGTFDPALAYALITNGGGPPPTSPSSTPSTTPSTTPSTTPSTTP
STTPSTTPSTPPSTTPSSPPSSSPAGCQVTYTRTNEWAGGFTANVSITSSKALSSWTVGF
TYGGDQQITNSWNGNHTQSGRNVTLTSLSYNGSIGAGQTLTGVGVQGTWTSSDAAPSAFT
LNGVACH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgttccccgacttctcttccccaggttctgcgcgccgacgcgggttcagtgcggtcgcg
gctaccgtcgccgcggtagccggactcgtggtcgccacccagttgggcggcgtggcgatg
gcgggcaccatcgcatcgggaacgcagttctacgccgacccgaactcccaagtcgtcaaa
tgggacgccgccaaccccggtgacgcccgcgagcctgccatcgcctcccagatcgcctcg
gtctcccaggggatctggttctccaactaccggccctcgaccgtgcagtcagacgtctcg
gcggtgacgaccgccgccgcggccgcggggaagacgccggtcctggtcgtgtacgagatc
cccaaccgggactgcggcggcgcgtcggccggcggcgcccccgacatttccagctacgag
aactacattcagagctttgccaacggactcggcagccaccaggtgatcgtcatcctggag
ccggactcgctggcgttgcagacctgcctcagctcgcagcaggccaccgaccgggacaac
gcgatcgccttcgccggggcgcacctgaagtccgccgacccggcggcgaaggtgtacctg
gacgccggccactcgagctggaactcgccgtcggcgcaggccgcggcgctgaacgcggcg
ggcgtcaagacgtcctcggacgggatcttctccaacgtgtccaacttccagaccacggca
tcagaggtctcctacgacaagcaggtgctggcagctctgggcagcccgtcgaacctgcac
atcgtggtcgacaccagccgcaacggcaacggtccggccggcagcgcctggtgcgacccg
tcgggccgggcactgggccaggctccgacggcgaacaccggtgatgcggccgtggacgcg
ttcctgtggatcaagcctccgggcgaggcggacggctgcgcggacgccgccggcacgttc
gaccccgcgctcgcctacgcgctgatcaccaacggcggcggcccgccgccgacgtcaccg
agttcgacgccgtcgaccacaccgtcaaccacgccgtcgaccacaccttcgaccacacct
tcgaccacgccttcgaccacgccttcgacaccaccgtcgacgacgccgagcagcccgccg
agctccagcccagccggctgccaagtcacctacacgaggacgaacgagtgggccggcggt
ttcaccgcgaacgtcagcatcaccagcagcaaggccctgagcagctggaccgtcggcttc
acctacggcggcgatcagcagatcacgaactcgtggaatgggaaccacacgcagtccggc
aggaacgtgaccttgaccagcctctcctataacggatccatcggcgctgggcagaccctg
accggcgtgggcgtccagggcacatggacgtccagcgacgcggcaccgagcgcgttcacc
cttaacggtgtggcctgtcactga

DBGET integrated database retrieval system