KEGG   Catenulispora acidiphila: Caci_6715Help
Entry
Caci_6715         CDS       T00967                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cai  Catenulispora acidiphila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Caci_6715
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Caci_6715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7744755..7745717)
Genome map
AA seq 320 aa AA seqDB search
MEAIGSGGPVERAVSQRVVVIGSINVDEVVGVAELPAPGETVLGRERATGLGGKGANQAV
AAAVAGAGAGDSGGRVALVGAVGADERGAMALEQLAEYGVDTSMVARLDGIASGRALVIL
SDAGENEIIVIGGANQAFDAGALSRDTLCDAAVMVVQGEVAPSVNRAALRLAAELGVRAV
VNLAPVQDLGEELAHADPLVVNEIEAAQLLEAGAELTGLQDVTDAAPRLRSLARSVLVTL
GASGAVLITADAIDHVCAPRPDRVRDTTGAGDALVGVLAAALAQGFEVRAAVERAVRAAS
LSVTEVGAAASYRAFRGRLR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgatcggatccggcggaccagtggagcgtgcggtgtcgcaacgagtggtcgtg
atcggcagcatcaacgtcgacgaggttgtgggcgtggcggagttgccggcgccgggggag
acggtgctcggacgcgagcgggcgaccggcttgggcgggaagggtgcgaaccaggctgtg
gccgccgctgtcgccggtgctggtgccggtgacagcggcggccgggtcgcgctcgtcggc
gccgtcggggcggacgaacgcggcgcgatggcgttggagcagctggcggagtacggggta
gacacgtcgatggtcgcgaggctcgacgggatcgccagcgggcgcgcgctggtgatactg
agcgatgccggggagaacgagatcatcgtgatcggcggcgcgaatcaggcttttgacgcc
ggagccctgagccgggacacgctgtgcgacgccgcggtgatggtggtgcagggcgaggtg
gcgccgagtgtgaaccgtgcggcgctgcggctggcggccgaactcggggtgcgcgcggtg
gtgaatctcgcgccggttcaggatctcggcgaggagctggcgcacgcggatccgttggtg
gtcaacgagatcgaggccgctcagctccttgaagccggcgctgaactcaccggcttgcag
gacgtcaccgacgccgcgccacgtctgcgcagcctcgcgcgctcggtgctggtgacgctc
ggcgcatccggtgctgtgctcatcaccgccgacgcgatcgaccatgtctgcgctccgcgt
cccgaccgcgtccgcgacaccaccggcgccggcgacgcactggtcggcgtgcttgccgcc
gcgttggcgcagggctttgaggtgcgcgcggcggtcgagcgtgcagtgcgggcggcgagt
ctgtcggtcaccgaggtcggtgcggctgcgagctatcgggcgtttcgggggcggctccgc
tag

DBGET integrated database retrieval system