KEGG   Catenulispora acidiphila: Caci_6784Help
Entry
Caci_6784         CDS       T00967                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cai  Catenulispora acidiphila
Pathway
cai00860  Porphyrin and chlorophyll metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caci_6784
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Caci_6784
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Caci_6784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Pyr_redox_2 Thi4 FAD_binding_2 AlaDh_PNT_C Pyr_redox NAD_binding_9 FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ACU75626
JGI: Caci_6784
UniProt: C7Q1S5
Position
7830989..7832455
Genome map
AA seq 488 aa AA seqDB search
MSAGQTSSQGSMSARGPGARPRSVAVIGAGVSGLAAAWYVKQALPDATVTVFEGSPRLGG
KLALGEVGGVQVDLGAESILNRRPEAVDLARAVGLADDIVHPATASASVWSRGELVPMPK
GHLMGVPGDPGVLAGLLSPAGLRRAEAGPALPSRSVLRVQAETDDIAVGAYVAETFGREV
VDRLVEPLLGGVYAGHADEISLRAAVPALVPAYESGEPLDEAVSKILAAQSAAANPKPVF
AGVRGGVGRFPAALTESCESAGVTIRRETMVRGLTRTADGWRLVSGPVPAPSAHEADAVI
VAVPGAPASRLLKDVAPVAAADLAGIEYASVALATFVFDDASLPAGSGFLVPPADGRFIK
ASTFSSVKWSWLAESGKTVVRASVGRHRETADLHQEDADLAASALADLRIALGAPDALGE
PVDWHVQRWGGGLPQYAVGHVARVERIRSAVAAQPGLAVCGAAYDGVGIAACVASALRAA
REISAGPA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggggcagacgtcgtctcagggttcgatgtcagcccgcgggcccggcgcgagg
ccgcgctcggtcgccgtgatcggcgcgggcgtctcgggtctggcggcggcgtggtacgtc
aagcaggcgctgccggacgcgaccgtcaccgtcttcgaaggctcgccccgcctcggcggc
aagctggcgctcggcgaggtcggcggcgtccaggtggacctcggcgccgagtcgatcctg
aaccgccgtccggaggccgtggatctggcgcgggccgtcggattggccgacgacatcgtg
catccggcgacggcatcggcgtcggtgtggagccgcggcgaactggtcccgatgcccaag
ggacatctgatgggcgtccccggagatccgggcgtcctggccggtctgctctcgccagcc
ggactcaggcgcgccgaggcgggaccggcgctgccgtcccgatcggtactgcgcgtgcag
gccgagaccgacgacatcgcggtcggcgcctacgtggcggagaccttcggccgcgaggtc
gtggaccggctcgtcgagccgctgctcggcggcgtctacgccgggcacgccgacgaaatc
tctttgcgcgccgcggttccagcgcttgtccctgcctacgagtcgggcgagccgctggac
gaagcggtgtccaagatcctcgcggcgcagtccgcggcggccaaccccaagccggtgttc
gcgggcgtccgcggcggcgtgggacggttcccggcggcgctgacagagtcctgcgaaagc
gcgggcgtcaccatccggcgcgagacgatggtcaggggactgacacgcacggccgacggc
tggcggctggtgtcgggtccggtgcccgcgccgagcgcgcacgaggcggacgcggtcatc
gtggcggttcccggcgctccggcttcgcgtctgctgaaggacgtcgctccggtcgcggcg
gcagatctcgcagggatcgaatacgcctcggtcgcgctggcgacgttcgtgttcgacgac
gcctcgctccccgccggcagcggcttcctcgtcccgccggcggacggccggttcatcaag
gcttcgacgttctccagcgtgaagtggtcctggctcgccgagtccggcaagacggtggtc
cgcgcctccgtcgggcggcatcgcgagaccgcagacctgcaccaggaggacgccgatctg
gcggcttcggcactggccgatctgcgtatcgcgctcggtgcgccggacgcgctcggggag
cccgtcgactggcacgtgcagcgctggggcggcgggctgccgcagtacgcggtcgggcac
gtggcgcgcgtggagcggatccgctcggcggtggcggcgcagccgggactcgcggtctgc
ggggcggcttacgacggcgtcgggatcgcggcgtgcgtcgcctcggcgctgcgagccgct
cgcgaaatcagtgccgggcccgcatag

DBGET integrated database retrieval system