KEGG   Catenulispora acidiphila: Caci_7101Help
Entry
Caci_7101         CDS       T00967                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cai  Catenulispora acidiphila
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Caci_7101
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Caci_7101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8260216..8262093
Genome map
AA seq 625 aa AA seqDB search
MAHERVLTIDGGRFLRGGREHRIVSAAIHYFRIHPDLWRDRLQRLRAMGCNTVECYIAWN
FHQPTPAAPRFDGWRDVAGFVRLAGELGFDVIARPGPYICAEWDFGGLPAWLLADENVRL
RTTDPVYLAAVDAWFDELIPVLAELQATRGGPVVAVQIENEYGSFGADPDYLDHLRKGLI
ERGVDTLLFTSDGPQELMLAGGTVPDVLATVNFGSRADEAFATLRRVRPDDPPVCMEFWN
GWFDHFGEPHHTRSAQDAARSLDEILAAGGSVNFYMGHGGTNFGFWAGANHSGVGTGDPG
YQPTITSYDYDAPVGEAGELTPKFHLFREVVGRYVELPDAQPPAPLPRLMPQTVAAPRIA
ALRDRLDLLATDPIHHPTPQPIEKLGHGFGLVHYRRRLDGPARTHTLRIEGVRDRAQVFA
DGKLLGMVERDIPERTLDLQIPDEGLDLELLVEPLGRVNYGPHLADRKGLIGGVRLDHQF
QFGWEHRVLPLDDPTGALALENQEAVTANQTAGPAFHRAAITVREPADGFLAVPSTARSL
VWLNGFLLGRLWDRGPQVTLYAPAPLWRAGANEIVVLALEPDAGTQSPDAQSPSAPSPDA
QGLEIELRGEPDLGPLATPSTHADY
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
gtggcccacgaacgcgtactgaccatcgacggcggccggttcctgcggggcgggcgggag
caccggatcgtctccgcggcgatccactacttccggatccatccggacctgtggcgcgac
cggctgcagcggttgcgcgccatgggctgcaacaccgtcgagtgctacatcgcctggaac
ttccatcagccgacgccggcggcgccgcggttcgacggctggcgggacgtcgccggattc
gtgcggctggcaggggaactcggcttcgatgtgatcgcgcgtcccggcccttatatctgt
gcggagtgggacttcggcgggctgccggcgtggctgctggccgatgagaacgtgcggctg
cgcaccaccgatccggtctatctggccgccgtggacgcgtggttcgacgagctgatcccg
gtcctggccgagctccaggcgacgcgcggcggaccggtcgtggcggtgcagatcgagaac
gagtacggcagcttcggcgccgatcccgactacctcgaccaccttcgcaagggtctgatc
gagcgcggcgtggacactttgctgttcacctccgacggcccgcaggagctgatgctggcc
ggcggcacggtcccggacgtgctggccaccgtgaacttcggctcgcgcgccgacgaggcg
ttcgcgacgctgcgccgcgtccgcccggacgacccgccggtgtgcatggagttctggaac
ggctggttcgatcacttcggcgagccacaccacacccgcagcgcgcaggacgccgcacgc
tccctcgacgagatcctcgccgccggcggctcggtcaacttctacatggggcacggcggc
accaacttcgggttctgggcgggcgccaaccattccggcgtgggcaccggcgatcccgga
tatcagcccacgatcaccagctacgactacgacgcgccggtcggcgaggccggcgagctg
acgccgaagttccacctgttccgcgaggtcgtcgggcgatacgtcgaactgcccgatgct
cagcctcccgctcccctgccccgtttgatgccgcaaaccgttgccgcgcctcggatcgcg
gcgctgcgagaccgcctggacctgctggcgacggacccgatccaccacccgacgccgcaa
ccgatcgagaagctcgggcacggcttcgggctcgtccactaccgccgccgcctcgacggt
cccgctcgtacccacacgctgcggatcgagggtgtccgcgaccgcgcgcaggtcttcgcg
gacggaaagctgctcgggatggtagagcgtgacatacccgagcggacgctggatctccag
atcccggatgagggcctggatctggagctcctcgtcgagccgctgggccgggtgaactac
ggcccgcatctggccgatcgcaagggcctgatcggcggcgtgcggctggaccaccagttc
cagttcggatgggagcaccgggtgctgccgctggacgatccgacaggtgcgttggcgctg
gagaatcaggaggctgtaacggcgaaccagactgccggtcccgctttccaccgcgccgcg
atcaccgtccgcgagcccgccgacggcttcctcgccgtcccctccacggcgcgaagtctg
gtctggctcaacggattcctgctcggacggctgtgggaccggggaccgcaggtcacgctc
tacgccccggcgccgctgtggcgcgccggcgcgaacgagatcgtggtgctggcgctggag
ccggatgccggtacgcagagccctgatgcgcagagccccagtgcaccgagccctgatgca
cagggcctggagatcgagctgcgcggcgagccggatctcggcccgctcgcgacgccctcc
acccacgcggactactga

DBGET integrated database retrieval system