KEGG   Catenulispora acidiphila: Caci_7155Help
Entry
Caci_7155         CDS       T00967                                 

Definition
glucodextranase N
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cai  Catenulispora acidiphila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Caci_7155
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Caci_7155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8323219..8326701
Genome map
AA seq 1160 aa AA seqDB search
MLGRFISPPRVGRRWLRSSLSAFAGLSLATVGVWASSSPVARAGTASGGPGTASFWNETS
GVQGFATALSPSSKVWYTLGNGGLENVFYPQTDNPDTYGLQYYVTDGSSFTDGEATNTKH
AIALADPASLTFTQTNTAASGKYAITKTYVADPARSVILVKTTFTNNGSTPLYLYADYLP
QLNNQGMGNIGSTDAGGDLVASNGPMASALAASTPFSSASTGYVGTASSGTAQLATGHTL
GTVYSGVSSSGHIDQTAQIPVAASGSTTFTLALGFDTTSAAAVSDVSASLSSGFAAVQSS
FQAGWHTWMSGLTTAPASVANNAGLLTQYETSLMEVKADEDKNYVGAFVAAPVTPWGSTV
SADGGGGHGYHLVWTRDEYQMASALLAAGDKQDASDALTYLENYEETSSGQVKQNTWLNG
NAMWGGNQQDEEADPIILAYQLGRTGSADFAKIKLLASFIAANGPTTGQERWEENGGYSP
ATIASEIAGLVCASNIATANGDSADAAAWLAKAQSWAGSVAGWTYTTSGPYGSGSYFLRL
TPDGQPNSGASIGLANGGGNHDDRTVVDQSFLDLVRLGVMPATASQVTNSLAVDDAQIGV
NTPEGQIDHRYDFDGYGETSSGADYTGAGTGNPWPVLTGERGEYDVAAGNLTGAQSALTT
MAGAASDGQISEQVWAGTNGTGGFSLGRPDNSANPLMWAMAQYVRLAMDISAGQNLDTPT
VVCQTFNACSAAPTTKPAAPTNLTVTATHTTNVSLSWSGSSLAAGYKVYRATGTGPAALV
ATVASTAYTDTKLTASTAYSYSVTAYNNVGESGPSNTVTTTTKTPVPPPNAPTGLTVSAA
ASTTVDLTWTAATDTSGGTVGGYNIYRATGTGTAALVASTSGTSFTDTGLTPSTGYTYSV
TATDTDGNESAASNSVTATTTANNVEVVTVTVPSYTDQTGLTVYMAGTLSALGGGQGDWA
ANGIAFTRVDATHWRATIHAAGPTTLSYKYTLGGAWANDEETASCGYVGNRSMQINGGTE
ADTVANWAGPYTCGSSPPPPPGGGTGGNGGTTETIAVTVPADTPASAQVYLAGNLSVLGG
GQGDWAANGVLMSRVDATHFTASVSAANASTTLQYKYTLNGTWSNNEETGSCGYVQNRSL
TVNGGTQTDTVANWKGYGGC
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcagattcatttcaccaccccgggtcgggcggcgatggctgcggtcgtcgctg
tccgcgttcgccgggttgtcgctggccactgtgggagtctgggcttcgtccagtcctgtg
gcgcgggctggtaccgcgtcggggggaccggggacggcctcgttctggaacgagaccagt
ggcgtgcaggggttcgccaccgcgctgagtccgagttcgaaggtctggtacacgctgggc
aacggcgggctggagaacgtcttctatccgcagaccgacaacccggacacctacgggctg
cagtactacgtcaccgacgggtcgagcttcaccgacggcgaggccaccaacaccaagcac
gcgatcgccttggccgatcccgcctcgctgacgttcacgcagaccaacaccgccgccagc
ggcaagtatgcgatcacgaagacctacgtcgccgatcccgcgcgttcggtgatcctggtg
aagaccacgttcaccaacaacggctccactccgctgtatctgtacgctgattacctcccc
cagctcaacaaccagggcatgggcaacatcggctccaccgacgccggcggggacctggtc
gcctccaacggcccgatggccagcgcactggccgcgtccacccccttcagcagtgcctcg
accggatacgtcggcaccgccagcagcggtacggcgcaactggcaaccggccacacgctc
ggcaccgtctacagcggcgtctcgagcagcggccacatcgaccagaccgcgcaaatccct
gtagccgcctcgggttcgaccaccttcaccctcgcgctcggcttcgacacgaccagcgcc
gcggccgtctccgacgtgtcggcgtcgctgtcgtcgggcttcgccgccgtccagtcctcc
ttccaagctggttggcacacctggatgagcggcctgaccaccgccccggcgtcggtcgcg
aacaacgccggactgctgacgcagtacgagacctccttgatggaggtcaaggccgatgag
gacaagaactacgtcggcgcgttcgtcgctgctccggtcacgccctggggctcgaccgtc
agcgccgacggaggtggcggacacggctaccacctggtgtggacgcgcgacgagtaccag
atggccagcgcactgctggcagccggcgacaagcaggacgccagcgacgcgctgacctat
ctggagaactacgaggagacctccagcggccaggtcaaacagaacacctggctcaacggg
aacgcgatgtggggcggcaaccagcaggacgaggaagccgaccccatcatcctggcctac
cagctcggccgcaccggcagcgccgacttcgccaagatcaagctcctggcgtccttcatc
gccgccaacggtccgaccaccgggcaggagcgctgggaggagaacggcggctactccccc
gccaccatcgcctccgagatcgccggcttggtgtgcgcgtcgaacatcgccaccgccaac
ggcgattccgcggacgccgccgcctggctcgccaaggcgcaaagctgggccggcagcgtc
gcggggtggacctacaccacgagcggtccctacggaagcggctcctacttcctgcgcctc
acccccgacggccagcccaactcgggagcctccatcggtctggccaacggcggcggcaac
cacgacgaccgcaccgtggtcgaccagagcttcctggacctggtacgcctcggcgtgatg
cccgccaccgcgagtcaggtcacgaactctctcgccgtcgacgacgcgcagatcggtgtg
aacacccccgaaggacagatcgaccaccgctacgacttcgacggctacggcgaaacctcc
tccggagcggactacaccggcgccggaaccggcaatccctggcctgtgctgaccggtgag
cgcggcgaatacgacgtggcggcgggcaacctgaccggcgcgcagtccgccctgaccacc
atggccggcgccgcgtccgacggccagatctccgagcaggtgtgggccgggaccaacggc
accggcggcttcagcctcggccgccccgacaactccgccaacccgctgatgtgggcgatg
gcgcagtacgtgcgcctggcgatggacatctccgcgggtcagaaccttgataccccgacc
gtggtctgccagacgttcaacgcctgctcggcagcaccgacgacgaagcccgccgcgccg
acgaacctgaccgtcaccgccacccacaccaccaacgtctcgctgtcctggtccggctct
tcgctcgcggccggctacaaggtgtaccgcgcgaccggcaccggtccggcggcgctggtc
gccacggtcgcatcgaccgcctatacggacaccaagctgaccgcctccacggcctacagc
tactccgtgaccgcgtacaacaacgtcggcgagtccggaccgtccaatacggtcacgacc
accaccaaaacccccgtcccgccgccgaacgcgccgaccggcctcacggtctccgccgcc
gccagcaccacggtcgacctgacgtggaccgcagccacagacacctctggtggaacggtc
ggcggctacaacatctaccgcgccaccggaaccgggaccgcagccctggtcgcctcgacg
agcggcaccagcttcacggacaccggtctgacgccgtccaccggctacacctactccgtc
accgcgaccgacacagacggaaacgaatcggccgcctcgaattccgtcaccgcgaccacc
accgcgaacaacgtcgaagtggtgaccgtgacagtcccctcatacaccgatcagaccgga
ctgaccgtctacatggccgggacgctgtccgcgctcggcggcgggcaaggtgactgggca
gccaacggcatcgcgttcacccgcgtggacgccacgcactggcgcgccaccatccacgcc
gcgggtccgaccacgctgtcgtacaagtacaccctcggcggtgcgtgggccaacgacgag
gagaccgcgtcctgcggctacgtgggcaaccgcagcatgcagatcaacggcggcaccgag
gccgataccgtcgccaactgggcaggtccctacacctgcggcagctcgccgccgccccct
cccggcggcggcacaggcggcaacggcggcaccaccgagacgatcgctgtgacagtgccc
gccgacaccccggcgagcgcccaggtctacctcgccggcaacctgtcggtcctcggcggc
ggccagggcgactgggcagccaacggcgtgctcatgtcccgggtcgacgcgacccacttc
accgcatccgtcagcgcggccaacgcatccaccacgctgcagtacaagtacacgctcaat
ggaacctggtcgaacaatgaggagacgggctcctgcgggtatgtgcagaaccgttccctc
accgtgaacggcggcactcagaccgacaccgtcgcgaactggaaggggtacggcggctgc
tga

DBGET integrated database retrieval system