KEGG   Catenulispora acidiphila: Caci_7612Help
Entry
Caci_7612         CDS       T00967                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
cai  Catenulispora acidiphila
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Caci_7612
Enzymes [BR:cai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Caci_7612
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Caci_7612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8834429..8835706
Genome map
AA seq 425 aa AA seqDB search
MADTSYTVHAVAGIPEVGPGDDVAALIGAAVTASGLGLRDGDILCVTSKILSKAEGRVVR
AGDREAAIDAEMVRLVARRGPTRIVQTRHGFVMAAAGVDASNTPAGTVLLLPEDPDGSAR
DIADALRDRFGVAVGVVVTDTFGRPWREGQTDVAIGCAYVNALMDHRGTIDAFGNELLVT
AAATADELAGAGEVVKGKADGVPVAVIRGLGDLVTAEPGLGVRPLIRSAESDMFSLGTTE
AMREGVLRRRTTQWFASDPVPGETVRRAVVAALTAPTPFSSTSSASSASSTSSASEGDGT
APWRFVLLESEMGRKTFTSALADSVLERAPYLVVPCYLATAATAGAGTGTEFVVASLGAA
VENFLVTLAADGIGSLWTDTDSDSVRELLALPDRWEPLGVIAIGKPAETTPSVPPRDPED
FITVR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacctcctacacggtgcacgcggtcgccgggatccccgaggtcgggcccggc
gacgacgtggcggcgctgatcggcgccgcggtgacggcctccgggctgggcctgcgcgac
ggcgacatcctctgtgtcacctccaagatcctgtccaaggccgagggccgcgtggtccgg
gccggcgaccgcgaggccgcgatcgacgccgagatggtccggctggtcgcgcgccgcggg
ccgacccggatcgtgcagacgcggcacggcttcgtgatggccgcggccggcgtggacgcc
tccaacaccccggcgggcaccgtgctgctgctgcccgaggaccccgacggctccgcccgg
gatatcgccgacgcgctgcgcgaccggttcggggtcgcggtgggggtcgtggtgaccgac
accttcgggcggccgtggcgggaggggcagacggacgtcgccatcggctgcgcctacgtc
aacgcgctgatggaccaccgcggcacgatagacgccttcggcaacgagctgctggtcacc
gcggcggccacggccgacgagctggccggcgccggcgaagtggtgaagggcaaggccgac
ggcgtgccggtcgcggtgatccgcgggctgggcgatctggtgaccgcggaaccgggactc
ggggtgcggccgctgatccgctccgcggagagcgacatgttctcgctggggacgacggaa
gcgatgcgcgaaggggtgctgcggcggcggacgacgcaatggttcgcttcggacccggtg
cccggggagacggtgcggcgcgcggttgtggccgccttgacggctcccactccgttcagc
tctacctcttcggcatcttcggcatcttcgacatcttcggcatccgaaggcgacggcacg
gctccgtggcggttcgtcctgctggagtccgagatggggcgcaaaaccttcaccagtgcg
ctggccgactccgtacttgagcgcgcgccttatctggttgtcccctgctatctggctaca
gcggctacagcgggtgccggtacgggtacggagttcgtcgtggcgtcgctcggcgcggcc
gtggagaacttcttggtgaccctcgccgccgacggcatcggatcgctgtggacggacaca
gactccgactctgtccgggagctcttagcgcttcccgacagatgggaaccgctcggagtc
atcgctataggaaaacccgcggagacaaccccctcggtgcctccgcgggatcctgaggac
ttcatcaccgtccgttga

DBGET integrated database retrieval system