KEGG   Catenulispora acidiphila: Caci_7718Help
Entry
Caci_7718         CDS       T00967                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cai  Catenulispora acidiphila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cai00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cai00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(8955280..8957064)
Genome map
AA seq 594 aa AA seqDB search
MGEQLLRDAAAVLQPGFVNDDSGRVPDWVRRALTEDGLGGVAYYGRNIAATPERTGELSA
ALRAENPHVLVAVDEEGGDVTRLDVATGSAFPGNYALGYVDDAELTETVARQIGRSLWRA
GINLNYAPDADLNTNPDNPVIGTRSFGSDPVVAARHSAAYVRGLQAAGVAGCAKHFPGHG
DTAVDSHHGLPLVQHSDKEWEKHLAPFRAAIEAGVKSVMTAHILAPRYDPEFPSTMSRKV
LVDLLRGELGFTGLVVTDGIEMAAIADTFGIAEGTVLALAAGVDAVCVGGGLRDEGDYLM
LRDALVDAVRAGRLPAERLHDAATRVRELGAWAAAQRAEVEGTYAAGGGFGRSGAVSANG
AGGSVSVSASGVGAVGADGANGEAAGPSSTPTATSVATPGSASVSASAASDGAQAIGLTA
ASRALTVSGAPLPPLTGPVSILEFVPLANNAAGTAVPWGLSPVLSELPAGSSAARFVEPG
AATSFAGDDDTAAALAAVRPRLVAVPYTPAGVSEAVAAAADRPLVVVVRDAHRHAWMASA
LAAATALRPDAIVVEMGIAYGLGEKSGGATMIATHGAALVSGLAVARLLTKGSV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtgggagagcaactgctgcgcgacgccgccgccgtccttcagccggggttcgtcaatgac
gactccggccgggtcccggactgggtgcgtcgcgccctgaccgaggacggtctcggtggt
gtcgcctactacggacggaacatagcggccacgccggagcgcaccggcgaactgtcggcg
gcgctgcgggcggagaacccgcacgtactggtcgccgtcgacgaggaagggggcgacgtc
acccggctcgacgtggccaccgggtcggcgttcccgggcaactacgccctgggctacgtc
gacgacgccgagctgaccgagacggtcgcccggcagatcggccgctcgctgtggcgcgcg
gggatcaatctgaactacgcgccggacgcggacctgaacaccaaccccgacaacccggtg
atcgggacccggtccttcgggtccgacccggtcgtggcggcgcggcactccgcggcgtac
gtcaggggactgcaggcggccggcgtggccggctgcgccaagcacttccccggacacggc
gacaccgccgtggactcgcaccacggcctgccgctggtgcagcactccgacaaggagtgg
gagaagcacctggcgccgttccgggccgcgatcgaggccggggtgaagtcggtgatgacc
gcgcacatcctggcgccgcgctacgacccggagttcccctcgaccatgagccgcaaggtc
ctggtggacctgctgcgcggcgagctgggcttcaccgggctggtggtcaccgacggcatc
gagatggccgccatcgccgacaccttcgggatcgccgaggggacggttctggcgctggcg
gcgggtgtcgacgcggtctgcgtcggcggcggcctgcgggacgagggcgactacctcatg
ctgcgggacgcgctggtggacgcggtgcgcgccggccggctgcccgccgagcggctgcac
gacgcggccacgcgcgtgcgggagctcggggcgtgggccgccgcgcagcgtgcggaggtg
gaggggacgtacgctgccggcggcggcttcgggcgctccggcgcggtgtcggcgaacggc
gccggaggctctgtctccgtgtctgcctcgggtgtcggcgcggtgggtgcggacggtgcg
aacggcgaagcggccggtccatcctcgacgcccacggcgacgtcggtggcgacaccgggt
tcggcgtcagtgtcggcgtcggcggcttcggacggtgcgcaggcgatcggcctgaccgcc
gcgtcgcgcgcgctcaccgtctccggcgccccgctgccgccgctgaccggtccggtctcc
atcctggagttcgtgccgctggccaacaacgcggccgggacggcggtcccctggggactg
agcccggtgctgtccgaactgccggccggcagctcggcggcgcggttcgtggagccgggc
gcggcgaccagcttcgccggcgacgacgacaccgccgccgcgctcgccgcggtgcgtccg
cggctggtcgcggtgccctacaccccggcaggggtctccgaagccgtggcagccgccgcg
gaccggccgctggtggtcgtcgtccgcgacgcgcaccggcacgcctggatggcctcggcg
ctggccgccgcgaccgccctgcggcccgacgcgatcgtggtcgagatggggatcgcgtac
ggtctgggagagaagtccggcggggcgacgatgatcgccacgcacggtgcggcgctggtg
tccgggctcgcggtcgccagacttctgacgaagggatccgtctag

DBGET integrated database retrieval system