KEGG   Catenulispora acidiphila: Caci_7946Help
Entry
Caci_7946         CDS       T00967                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cai  Catenulispora acidiphila
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9218366..9219304
Genome map
AA seq 312 aa AA seqDB search
MSSNADGTPGGATESAPDPADVPQSTLRLGAYEYGPDQRLVMAIVNRTPDSFYDKGATFT
DAAALDRVERALSEGADLIDIGGVKAGPGDAVDLAEETRRVVPFVAEVRKRFPEAVISVD
TWRAEVGDAVCAEGADVLNDAWGGWDPRLAEVAARHAVALVCTHAGGVEPRTRPHRVGYA
DIMADILERTVHGEAERAAALGVPRDRILIDPGHDFGKNTRHSLEATRRLAEMTATGWPV
LVSLSNKDFVGETLNRPVKERLTGTLATTAVSAWLGARVYRVHEVAETRQVLEMVSAIQG
LREPAVAKRGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgaacgcggacggcacccccggcggcgccaccgagagcgccccggacccggcc
gacgtcccgcagagcacgctgcgcctgggagcctacgagtacggtcccgatcagcggctc
gtgatggcgatcgtgaaccgcaccccggactccttctacgacaagggagccaccttcacc
gacgccgccgccctggaccgggtcgagcgggcgttgagcgagggcgcggacctcatcgac
atcggcggcgtgaaggccggtcccggcgacgccgtggacctcgccgaggagacgcgccgc
gtcgtccccttcgtcgccgaggtccgcaagcggttcccggaggcggtcatctccgtggac
acctggcgcgccgaagtcggggacgcggtgtgcgccgagggcgccgacgtcctcaacgac
gcctggggcggctgggacccgcgtctggcggaggtcgcagcccggcacgcggtggcgctg
gtgtgcacgcacgcagggggcgtggaaccgcgcacccgcccgcaccgcgtcggctacgcg
gacatcatggccgacatcctggagcgcacggtccacggcgaggccgagcgcgcggcagcc
ctcggcgtcccgcgcgaccgcatcctgatcgaccccggccacgacttcggcaagaacacc
cgccactccctggaggcgacgcgccgcctggcggagatgaccgcgaccggctggccggtc
ctggtgtcgctgtcgaacaaggacttcgtcggcgagaccctgaaccgcccggtgaaggag
cgcctgaccggcacgctcgccaccaccgcggtctcggcgtggctcggcgcccgggtctac
cgggtgcacgaggtcgccgagacgcggcaggtgctggagatggtgtcggcgatccaggga
ctgcgggagcccgcggtcgccaagcgggggctagcttag

DBGET integrated database retrieval system