KEGG   Catenulispora acidiphila: Caci_7987Help
Entry
Caci_7987         CDS       T00967                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cai  Catenulispora acidiphila
Pathway
cai00020  Citrate cycle (TCA cycle)
cai00640  Propanoate metabolism
cai00660  C5-Branched dibasic acid metabolism
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01120  Microbial metabolism in diverse environments
cai01130  Biosynthesis of antibiotics
cai01200  Carbon metabolism
Module
cai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caci_7987
   00640 Propanoate metabolism
    Caci_7987
   00660 C5-Branched dibasic acid metabolism
    Caci_7987
Enzymes [BR:cai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Caci_7987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACU76810
JGI: Caci_7987
UniProt: C7QGW0
Position
complement(9265166..9266344)
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQARDIFAKHGVPVLGGEVAETPEQAEAAAEKLGGRVVVKAQVKVGGRGKAGGVK
LAEGPADAKEKAAAILGMDIKGHTVHKVMLAQTAEIEAEYYVSFLLDRSNRTFLAMASVE
GGMEIEEIAVSKPEALAKVPVDAAAYHEGLSQEKADEIVKAANFPHHVADQVAATLVTLW
DVFVKEDATLVEVNPLVKTKAGKIVALDGKVSLDENASFRHEDHEALEDKASADPLEAKA
KAKHLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGNVKPANFLDIGGGASAEVMAN
GLDIILNDPAVKSVFVNVFGGITACDAVANGIVEAFKLLGAEAGSKPLVVRLDGNNAELG
RQILVDAKLPGVEQVDTMDGAADRAAELANAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttttcgagtaccaggcgagggacatcttcgctaagcacggtgtgccggtgctg
ggcggcgaagtggccgagaccccggagcaggcggaagccgctgccgagaagctgggcggc
cgggtggtcgtcaaggcccaggtgaaggtcggcggccgcggcaaggccggcggcgtgaag
ctggccgagggcccggccgacgccaaggagaaggccgccgcgatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggcccagaccgccgagatcgaggcggagtac
tacgtctccttcctgctggaccggtccaaccgcaccttcctggcgatggccagcgtcgag
ggcggtatggagatcgaggagatcgcggtctccaagcccgaggcgctggcgaaggtcccg
gtcgacgccgcggcctaccacgagggtctgtcgcaggagaaggccgacgagatcgtcaag
gccgcgaacttcccgcaccacgtggccgaccaggtcgccgcgacgctggtgaccctgtgg
gacgtcttcgtcaaggaggacgccaccctggtcgaggtcaacccgctggtgaagaccaag
gccggcaagatcgtggcgctggacggcaaggtctcgctggacgagaacgcctccttccgc
cacgaggaccacgaggcgctggaggacaaggcctcggcggacccgctggaggccaaggcc
aaggccaagcacctgaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggc
gcgggcctggtcatgtccaccctggacgtggtcgcctacgccggggagaagcacggcaac
gtcaagccggccaacttcctggacatcggcggcggcgcctcggccgaggtcatggccaac
ggtctggacatcatcctgaacgacccggcggtgaagtcggtgttcgtcaacgtcttcggc
ggcatcaccgcgtgcgacgcggtggccaacggcatcgtcgaggccttcaagctgctcggc
gccgaggccggcagcaagccgctggtcgtccgtctggacggcaacaacgccgagctgggc
cgccagatcctggtggacgccaagctgcccggcgtggagcaggtcgacacgatggacggc
gccgcggaccgcgcggccgagctggcgaacgcgcgctaa

DBGET integrated database retrieval system