KEGG   Catenulispora acidiphila: Caci_8016Help
Entry
Caci_8016         CDS       T00967                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cai  Catenulispora acidiphila
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cai03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9308442..9309314)
Genome map
AA seq 290 aa AA seqDB search
MPELPEVEVVRRGLERWAVGRTVAAAEVLHPRAIRRHPDGPEDFAARAAGLTLLSAERRG
KFLWLPLGEGETSVGEAVTGHLGMSGQLLLQPSGTPDEKHLRIRFTFADDGPELRFVDQR
TFGGMALEKLEHDRQGVVVPASVVHIARDVLDPEFDVDFFHSELRRRNTGLKRALLDQTR
VSGIGNIYADEALWIARLHYDRPTSKMRRPDTDRVLEAAREVMTAALAVGGTSFDSLYVN
VNGESGYFARSLHAYGREGEPCERCGTPIKRESFMNRSSYFCPKCQRLPR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactgcctgaagtagaagtcgtccgccgcggtctggaacgctgggctgtcggg
cgcaccgtcgccgccgccgaggtgctgcatccgcgggcgatccgccgccatcccgatgga
cccgaggacttcgccgcgcgtgccgccgggctcacgctgctcagcgcggagcgccggggc
aagttcctgtggctgccgctcggtgagggcgagaccagtgtcggcgaggcggtgaccggg
catctcgggatgagcggccagctgctgctccagccctccggtactccggatgagaagcac
ctgcgcatccgcttcaccttcgccgacgatggtcccgagctgcgcttcgtcgaccagcgc
accttcggcggcatggcgctggagaagctggagcacgaccggcagggcgtggtcgtcccg
gcttccgtcgtccacatcgcgcgcgatgtcctggaccccgagttcgacgtcgacttcttc
cacagcgagctgcgccgccgcaacaccggcctgaagcgcgcgctgctggaccagacccgg
gtcagcggtatcggcaacatctacgccgacgaggcgctgtggatcgcgcgcctgcactac
gaccgcccgacctcgaagatgcgccgccccgacaccgaccgggtgctcgaggcggcgcgc
gaggtgatgaccgccgctctcgccgtcggcgggacgtccttcgacagcctgtatgtgaac
gtcaacggcgagagcggctacttcgcccggtcgctgcacgcctacggccgcgaaggagag
ccctgcgaacgctgcgggacgccgatcaagcgcgagtcgttcatgaatcggtcgagctac
ttctgtccgaagtgtcagcggctgcctcgctag

DBGET integrated database retrieval system