KEGG   Catenulispora acidiphila: Caci_8105Help
Entry
Caci_8105         CDS       T00967                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cai  Catenulispora acidiphila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cai00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cai00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9398454..9399971
Genome map
AA seq 505 aa AA seqDB search
MDAPKISIIPKPLRIQAGSGRLTFDSATVVNASNGHPELGPEGYTLVIDDDGITFVTGTE
TGQFYAEQTLKQLLPPDALRSDAGDKAWPLPYVTITDAPRFRWRGAMLDVARHFLPKRDV
LRFLDLMALHKLNVLHFHLTEDQGWRIEIKQYPKLTEVGGWRRETVGDGRPHGGFYTQDD
IREIVAYATERHITVVPEIDIPGHSTAAIAAYPELGNQDVPSAEEPREVWTRFGIATSVL
NVEDTTVEFYKTVMDEICDLFPGEFVCLGGDECPKDEWKASARAQARKAELGLATEEDLQ
AWFMNQLSEHVASKGRKLLGWDEILEGELFPGTVVSSWRGTDGAVEAARRGHDTLTSPYG
WVYFDYRQSDEEGEPGAPWAAPTSLERAYSFEPIPEDMPEELADHVIGSEATLWSEYIPD
ARVHDYQAWPRLAAFSETVWSTPDRDFAEFQSRLEKHLERLDALGVEYRPLDGPHPWQKQ
PAPHWKADPNEAEAADGTESTESTE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcccaagatctcgatcatccccaaaccgctgcggatacaagccggatccggt
cggctcacgttcgactccgcaaccgtcgtgaacgcctcgaacgggcatcccgaactcggc
ccggagggctacacgctggtcatcgacgacgacggcatcaccttcgtcaccggcaccgag
accggccagttctacgccgagcagacgctgaagcagctcctgccgcccgacgcgctgcgc
tccgacgccggcgacaaggcctggccgctgccctacgtgacgatcaccgacgccccgcgc
ttccgctggcgcggcgcgatgctcgacgtggcacgccacttcctgcccaagcgcgacgtg
ctgcgcttcctggacctgatggcgctgcacaagctgaacgtcctgcacttccacctgacc
gaggaccagggctggcgcatcgagatcaagcagtatccgaagctcaccgaggtcggcggc
tggcgccgggagacggtcggcgacggccgcccgcacggcggcttctacacgcaggacgac
atccgcgagatcgtcgcctacgccaccgagcggcacatcaccgtggtccccgagatcgac
atccccgggcactccaccgccgccatcgccgcctaccccgagctgggcaaccaggacgtg
cccagcgccgaggaaccgcgcgaggtgtggacccggttcgggatcgccacctcggtgctg
aacgtcgaggacacgaccgtcgagttctacaagacggtgatggacgagatctgcgacctg
ttccccggcgagttcgtctgcctcggcggcgacgagtgcccgaaggacgagtggaaagcc
agcgcccgggcccaggcccgcaaggcggaactgggactggcgaccgaagaggatctgcag
gcctggttcatgaaccagctcagcgagcacgtcgcgtcgaagggacgcaagctgctcggc
tgggacgagatcctggaaggcgaactgttcccgggcaccgtcgtgtcctcctggcgcggc
accgacggcgcggtcgaggcggcacggcgcggacacgacaccctcaccagcccctacggc
tgggtctacttcgactaccgccagtccgacgaggaaggcgagccgggcgccccctgggcc
gcgccgacctcgctggagcgcgcctacagcttcgagccgatccccgaggacatgcccgaa
gaactcgccgaccacgtcatcggctccgaggccaccctctggagcgagtacatccccgac
gcccgggtccacgactaccaggcctggccccgcctcgcagccttcagcgaaacagtgtgg
tccacccccgaccgcgacttcgcggagttccagtcgcgcctggagaagcacctggagcgc
ctcgacgcactcggagtggagtaccgccccctcgacggtccgcatccatggcagaagcag
ccggcgccgcactggaaggccgacccgaacgaggccgaggcggctgacggcacggaaagc
accgagagcacggagtag

DBGET integrated database retrieval system