KEGG   Catenulispora acidiphila: Caci_8153Help
Entry
Caci_8153         CDS       T00967                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cai  Catenulispora acidiphila
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cai00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9454744..9455727
Genome map
AA seq 327 aa AA seqDB search
MASTEGGSTERPAPIGPVDSSKTPRYAGFATFARLPRLDQLPAGEKADVAVLGAPFDSGV
SYRPGARFAPAAVREASRLLRPYNPGLDFSPFEAVQVADAGDISINPFLLDEALEQIEAH
SGELVGAGSKLVTIGGDHTIALPLLRTMARRHGPVALLHFDAHLDTWDTYFGAPYTHGTP
FRRAFEEGILDSSAVAHVGTRGPLYSKQDLSDDQRMGFGIVTSADVMRQGVDAVVQALRE
RIGSRPLYVSIDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLDGLNLVGADVVEVAPP
YDHAEITSVAAAHVAYDLVTLLAMQGR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcactgaaggcggcagcacggaacgtccggcaccgataggaccggtcgactcc
tcgaagaccccgcgctacgcgggcttcgcgacgttcgcgcggctgccgcgcctggaccag
ctcccggcgggcgagaaggcggacgtcgcggtgctgggcgcccccttcgactccggggtc
tcctatcgccccggcgcccgcttcgccccggcggcggtgcgcgaggcctcaaggctgctg
cggccctacaaccccggcttggacttctcgccgttcgaggcggtgcaggtcgccgacgcc
ggcgacatctccatcaaccccttcctgctcgacgaggcgctggaacagatcgaggcgcac
tccggcgagctggtcggcgccggctccaagctggtgaccatcggcggcgaccacaccatc
gccctgccgctgctgcgcaccatggcgcgccggcacggtccggtggcgctgctgcacttc
gacgcgcacctggacacctgggacacctacttcggcgcgccgtacacgcacggcacgccg
ttccgccgcgccttcgaagaaggcatcctcgactcctcggcggtggcacacgtcggcacg
cgcggcccgctctacagcaaacaggacctcagcgacgaccagcgcatgggcttcggcatc
gtgacgtccgcggacgtgatgcgccagggcgtggacgccgtcgtgcaggcgctgcgcgag
cggatcggcagccggccgctgtacgtctcgatcgacatcgacgtcctggacccggcgcac
gcccccggcacgggcacccccgaggccggcggcatgaccagccgcgagctgctggagatc
ctgcgcggcctggacgggctgaacctcgtcggcgccgacgtggtcgaggtggcgccgccg
tacgaccacgccgagatcacctcggtcgccgccgcgcacgtcgcctacgacctggtgacg
ctgctggcgatgcaaggacgctga

DBGET integrated database retrieval system