KEGG   Catenulispora acidiphila: Caci_8222Help
Entry
Caci_8222         CDS       T00967                                 

Definition
(GenBank) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cai  Catenulispora acidiphila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caci_8222
   01230 Biosynthesis of amino acids
    Caci_8222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caci_8222
  Energy metabolism
   00680 Methane metabolism
    Caci_8222
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caci_8222
Enzymes [BR:cai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Caci_8222
Exosome [BR:cai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Caci_8222
  Exosomal proteins of melanoma cells
   Caci_8222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(9534360..9535115)
Genome map
AA seq 251 aa AA seqDB search
MTAEYRLILLRHGESEWNAKNLFTGWVDVNLNAKGEAEAVRGGELLREQDLLPDVVHTSV
LRRAIRTANLSLEAADRHWIPVRRSWRLNERHYGALQGKDKAATLAEFGEEQFMLWRRSY
DVPPPPLAKDDQYSQFEDPRYAGLPTELRPQTECLKDVVDRMLPYWYDAIVPDLRTGNTV
LVAAHGNSLRALVKHLDGISDADIAALNIPTGIPLLYTLDADLRPTKTGGEYLDPEAAAA
SIEAVKNQGKK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgaataccgcctcatcctgctccgccacggcgagagcgagtggaacgccaag
aacctgttcaccggctgggtggacgtcaacctcaacgccaagggcgaggccgaggccgtg
cgcggcggcgaactgctgcgcgagcaagacctgctcccggacgtggtccacacctcggtg
ctccgccgcgcgatccgcaccgcgaacctgtcgctggaagccgccgaccgccactggatc
ccggtccgccgcagctggcgcctgaacgagcggcactacggcgccctccagggcaaggac
aaggccgcgaccctggccgagttcggcgaggagcagttcatgctctggcgccggtcctac
gacgtccccccgccgcccctggccaaggacgaccagtactcgcagttcgaagacccccgc
tacgccggcctgcccacggaactgcgcccgcagaccgagtgcctgaaagacgtcgtcgac
cgcatgctcccctactggtacgacgcgatcgtcccggacctgcgcaccggcaacaccgtc
ctggtcgccgcccacggcaactccctccgcgccctggtgaagcacctcgacggcatctcc
gacgcggacatcgccgccctgaacatccccaccggcatccccctgctctacaccctggac
gccgacctgcgcccgaccaagaccggcggggagtacctggacccggaggccgccgcggct
tcgatcgaggcggtcaagaaccaggggaagaagtag

DBGET integrated database retrieval system