KEGG   Catenulispora acidiphila: Caci_8420Help
Entry
Caci_8420         CDS       T00967                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cai  Catenulispora acidiphila
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(9748669..9749223)
Genome map
AA seq 184 aa AA seqDB search
MSEAATGESAVRVHTAVLAIGGNLGDRLANLQSAIDSLADTPTLAIAWLSPVYETAPLLA
EGADPQDDYLNAVLGVTSALPPDMLLMRTQAIEEALGRTRKIHWGARTIDIDIVQVDDLV
SDDPELTLPHPRAAQRAFVLAPWHDARPDDVLTGAGPIADLLAALGGAAAQGAARRDDLE
LLLP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcagccaccggcgagagcgccgtccgcgtccacaccgccgtcctggcgatc
ggcggcaacctcggcgaccgcctggccaacctgcagtccgcgatcgactccttagccgac
accccgaccctggccatcgcctggctgtccccggtctacgagaccgccccgctgctggcc
gagggcgccgacccccaggacgactacctcaacgcggtcctcggtgtgacctccgcgctg
ccgccggacatgctcctgatgcgcacgcaggcgatcgaggaagccctgggccgcacccgc
aagatccactggggcgcccgcacgatcgacatcgacatcgtccaggtcgacgacctggtc
tccgacgacccggagctgacgctgccgcacccgcgagcagcgcagcgcgccttcgtcctc
gccccctggcacgacgcgcgccctgatgacgtcctgaccggcgccggacccatcgccgac
ctgctggccgcgctcggcggggcggcggcgcagggtgcggcgcggcgggacgatctggaa
ctgctgctgccgtag

DBGET integrated database retrieval system