KEGG   Caulobacter sp. K31: Caul_0232Help
Entry
Caul_0232         CDS       T00651                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cak  Caulobacter sp. K31
Pathway
cak00020  Citrate cycle (TCA cycle)
cak00310  Lysine degradation
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
Module
cak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caul_0232
  Amino acid metabolism
   00310 Lysine degradation
    Caul_0232
Enzymes [BR:cak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caul_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABZ69369
JGI: Caul0232
UniProt: B0T3D4
Position
254792..256036
Genome map
AA seq 414 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGEAVKKDEVLVELETDKVSLEVASPSDGVLASISA
EEGATVVPGTVLGVVTEGGAATAAPAAPAPKAAAAPAPAPAPAPAPTPAPAPVAAAAPAP
TAAAPVSPAPARIAAENNLDLSKVAGTGKDGRVTKGDALAALEARAAAPAPAAAPAAPRA
IHEREERVKMTRLRQTIARRLKEAQNNAAMLTTFNEVDMSAVMALRNSYKDIFEKKHGVK
LGFMSFFTKAVVAALKAVPDVNAEIDGTDIVYKNHYDIGVAVGTEKGLVVPVVRDADVLS
LAEIEKAIGALGKKARDGQLAIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAI
KERAMVVGGKIEVRPMMYLALSYDHRVVDGQGAVTFLVKVKEALEDPQRLLLEL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacccccgccctcggcgaatccgtcaccgaagcgacggtggcgcgc
tggaccaagaaggccggtgaagcggtgaagaaagacgaggtcctcgtcgaactcgaaacc
gacaaggtcagcctggaagtggcctccccgtcggacggcgtgctggcctcgatcagcgcc
gaggaaggcgcgaccgtggttccgggtacggtgctgggcgtggtgaccgaaggcggcgcg
gcgaccgccgctccggccgccccggctccgaaggctgccgctgctccggccccggccccg
gccccggcgcccgcgccgaccccggctcctgccccggtcgccgccgctgctccggccccg
accgccgccgccccggtcagcccggcgccggcccgcatcgccgccgagaacaacctggat
ctctcgaaggtcgccggcaccggcaaggacggccgggtgaccaagggcgacgccctggcc
gctctggaagcccgcgccgccgccccggctccggccgccgccccggccgcgccgcgcgcc
atccacgagcgcgaagagcgcgtgaagatgacgcgcctgcgtcagacgatcgcccgccgc
ctgaaggaagcccagaacaacgccgccatgctgacgaccttcaacgaggtcgacatgagc
gcggtgatggccctgcgcaattcgtacaaggacatcttcgagaagaagcacggcgtgaag
ctgggcttcatgtcgttcttcaccaaggcggtcgtcgccgccctgaaggccgtgccggac
gtcaacgccgagatcgacgggaccgacatcgtctacaagaaccactacgacatcggcgtc
gccgtcggcaccgaaaagggcctggtggttccggtcgtccgcgacgccgacgtgctgagc
ctggccgagatcgaaaaagccatcggcgccctgggcaagaaggcccgcgacggccaactg
gccatcgaggacatgcaaggcggcaccttcaccatcaccaacggcggcatctacggctcg
ctgatgtcgaccccgatcctcaacgcgccgcagtccggcatcctgggcatgcacgcgatc
aaggagcgggccatggtggtcggcggcaagatcgaggtgcgcccgatgatgtacctggcg
ctcagctacgaccaccgcgtggtcgatggccagggcgcggtgaccttcctggtcaaggtc
aaggaagccctggaagacccgcagcgcctgctgctggagctgtag

DBGET integrated database retrieval system