KEGG   Caulobacter sp. K31: Caul_0232Help
Entry
Caul_0232         CDS       T00651                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cak  Caulobacter sp. K31
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caul_0232
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caul_0232
  Amino acid metabolism
   00310 Lysine degradation
    Caul_0232
Enzymes [BR:cak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caul_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
254792..256036
Genome map
AA seq 414 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGEAVKKDEVLVELETDKVSLEVASPSDGVLASISA
EEGATVVPGTVLGVVTEGGAATAAPAAPAPKAAAAPAPAPAPAPAPTPAPAPVAAAAPAP
TAAAPVSPAPARIAAENNLDLSKVAGTGKDGRVTKGDALAALEARAAAPAPAAAPAAPRA
IHEREERVKMTRLRQTIARRLKEAQNNAAMLTTFNEVDMSAVMALRNSYKDIFEKKHGVK
LGFMSFFTKAVVAALKAVPDVNAEIDGTDIVYKNHYDIGVAVGTEKGLVVPVVRDADVLS
LAEIEKAIGALGKKARDGQLAIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAI
KERAMVVGGKIEVRPMMYLALSYDHRVVDGQGAVTFLVKVKEALEDPQRLLLEL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacccccgccctcggcgaatccgtcaccgaagcgacggtggcgcgc
tggaccaagaaggccggtgaagcggtgaagaaagacgaggtcctcgtcgaactcgaaacc
gacaaggtcagcctggaagtggcctccccgtcggacggcgtgctggcctcgatcagcgcc
gaggaaggcgcgaccgtggttccgggtacggtgctgggcgtggtgaccgaaggcggcgcg
gcgaccgccgctccggccgccccggctccgaaggctgccgctgctccggccccggccccg
gccccggcgcccgcgccgaccccggctcctgccccggtcgccgccgctgctccggccccg
accgccgccgccccggtcagcccggcgccggcccgcatcgccgccgagaacaacctggat
ctctcgaaggtcgccggcaccggcaaggacggccgggtgaccaagggcgacgccctggcc
gctctggaagcccgcgccgccgccccggctccggccgccgccccggccgcgccgcgcgcc
atccacgagcgcgaagagcgcgtgaagatgacgcgcctgcgtcagacgatcgcccgccgc
ctgaaggaagcccagaacaacgccgccatgctgacgaccttcaacgaggtcgacatgagc
gcggtgatggccctgcgcaattcgtacaaggacatcttcgagaagaagcacggcgtgaag
ctgggcttcatgtcgttcttcaccaaggcggtcgtcgccgccctgaaggccgtgccggac
gtcaacgccgagatcgacgggaccgacatcgtctacaagaaccactacgacatcggcgtc
gccgtcggcaccgaaaagggcctggtggttccggtcgtccgcgacgccgacgtgctgagc
ctggccgagatcgaaaaagccatcggcgccctgggcaagaaggcccgcgacggccaactg
gccatcgaggacatgcaaggcggcaccttcaccatcaccaacggcggcatctacggctcg
ctgatgtcgaccccgatcctcaacgcgccgcagtccggcatcctgggcatgcacgcgatc
aaggagcgggccatggtggtcggcggcaagatcgaggtgcgcccgatgatgtacctggcg
ctcagctacgaccaccgcgtggtcgatggccagggcgcggtgaccttcctggtcaaggtc
aaggaagccctggaagacccgcagcgcctgctgctggagctgtag

DBGET integrated database retrieval system