KEGG   Caulobacter sp. K31: Caul_0293Help
Entry
Caul_0293         CDS       T00651                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cak  Caulobacter sp. K31
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caul_0293
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Caul_0293
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Caul_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
324940..327285
Genome map
AA seq 781 aa AA seqDB search
MTFVAKPFAKLAALGASVAVLAFASASVAATPTLTLTPAPAQAEMGQGVFALTARTRIFV
AKGDVEARVVASQLSDMLFKARGLKPAVVEGAPPAGEAAIVLVRTQAAPEAGIGDTAEAY
LLDVAPTGVTITAPKRAGLFYGAVSVWQLAVQDAAKGPADLPAVSIVDAPRFAWRGFMLD
SARHVQSIDTIKAILDAMAAHKLNVLHWHLVDDQGWRLEIRKYPRLTSEGAWRAPAGAAG
KDPKTGKPIRYGGFYTQDQVRDLVAYAAARGVTIVPEIEMPGHALAPLVAYPQFGMTKTP
PRASMGDWGVFPYLYRPSEETFTFLNDVLDEVMDLFPSPYIHVGGDEAVKDQWKASPEVQ
AQIQALGVKDEHGLQSWFIQRAEKHINARGRRMIGWDEILEGGLAPNATVMSWRGVDGAV
AAASQGHDAVLAPDSTLYMDRRQSASADEPPGRIKITSLKDVYAFDAAPAALTQAQRAHI
LGLQATSFTEHMRTDERLERMTFPRLVAVAENGWTPEAQRDWTRFAARLPAETARLDALG
VAHDTVPYEPQATLTPAADGEISVALASGLGLGEIRYTTDGQAPTKTSALYDAPLAVAPG
KTLRVRTFLEDDALGRIRDYPISLAAARTRNSHQLETCGNGINLSLEDDAPVTGPRAVFA
VDLMNPCWVWKGADLSSVLKLTARIGQVPFNFQIGADKARIPLRAPATPDGELEVRLDGC
AGERIAVLPLGAAARGPAMGTVSGVVPAKGGVHDLCLSFTARGVEPTLVLDQVTLTPTHK
N
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgtagccaagcccttcgccaaactcgccgccctgggcgcatcggtcgccgtc
ctggccttcgcctcggccagcgtcgccgcgacgccgaccctgaccttgacgccggcgccc
gcccaggccgagatggggcaaggggtcttcgccctgaccgcccggacccggatcttcgtc
gccaagggcgatgtcgaggccagggtcgtggccagccagctttccgacatgctgttcaag
gcccgaggcctgaagcccgccgtcgtcgagggcgcgccgcccgcaggcgaggccgcgatc
gtcctggtccggacccaggccgcccctgaagcaggaattggcgacacggccgaggcctac
ctcctcgacgtcgccccgaccggcgtcaccatcaccgctcccaagcgcgccggtctgttc
tacggcgcggtcagcgtctggcaactggccgtgcaggacgccgccaagggtcccgcggac
ctgccggcggtcagcatcgtcgacgccccgcgtttcgcctggcgcggcttcatgctcgac
agcgcccgccacgtccagagcatcgacaccatcaaggcgatcctcgacgccatggccgcc
cacaagctcaatgtcctgcattggcatctggtcgatgaccaagggtggcggctggagatc
aggaaatatccgaggctgacgtccgaaggggcctggcgcgcgccggcaggggcggcgggc
aaggaccccaagaccggcaagccgatccgctacggcggcttctacacccaggaccaggtg
cgcgacctagtcgcctacgccgccgcgcgcggcgtcaccatcgtgcccgagatcgagatg
ccgggccacgctctggcgccgctggtggcctatccccagttcggcatgacgaagactccg
ccgcgcgccagcatgggcgactggggcgtgttcccctatctctacaggcccagcgaagag
acgttcacgttcctcaacgacgtgctcgacgaggtgatggacttgttcccctcgccctat
atccatgtgggcggcgacgaggcggtcaaggatcagtggaaggccagccccgaggtccag
gcccagatccaggccttgggcgtcaaggacgagcacggcctgcagagctggttcatccag
cgggccgagaagcacatcaacgcccgcggccggcggatgatcggctgggacgagatcctt
gaaggcggcctggcccccaacgccacggtgatgtcctggcgcggcgtcgacggcgcggtc
gccgccgcctcgcagggtcacgacgccgtcctggccccagacagcacgctctacatggac
cgccggcagagcgcctcggccgacgagccgcctggccggatcaagatcaccagcctcaag
gacgtctacgcgttcgacgccgccccggccgcgctcacacaggcccagcgcgcccacatc
ctgggcctgcaggccacgtcgttcaccgagcacatgcgcaccgacgagcgactggaaagg
atgaccttcccccggctggtcgcggtggccgagaatggctggacgcctgaggcccagcgc
gactggacccgcttcgccgcccgcctgccggccgagaccgcgcggctggacgcgctgggt
gtcgcccacgacaccgtgccctacgagccccaggcgaccctgaccccggcggcggacggc
gagatctcggtcgccctggcctcgggtctgggcctgggtgagatccgctacaccaccgac
ggccaggcgccgaccaagacctccgcgctgtatgatgcgcctctcgcggtcgcgcccggc
aagacgctccgtgtccggacgttcctcgaagatgacgccctgggccggatccgcgactac
cccatcagcctggcggcggcccggacgcgcaacagccatcagctcgagacctgcggcaac
ggcatcaatctctcattggaggacgatgcgccggtcacgggtccgcgcgccgtgttcgcg
gtcgacctgatgaacccctgctgggtgtggaagggcgcggacctgtcctcggtcctgaag
ctgacggctcgcattggccaggtcccgttcaacttccagatcggcgccgacaaggccagg
atcccgttgcgggcgccagcgacgccggacggcgagctcgaagtgcgcctcgacgggtgc
gcgggcgagcggatcgccgtcctcccgctaggcgccgcggcgcgcggaccggccatggga
accgtttccggcgtggtccccgccaagggtggcgtccacgacctctgcctcagctttaca
gcgcgcggcgtcgagccgacgctggttctcgaccaggtcacgctgaccccaacccacaag
aactag

DBGET integrated database retrieval system