KEGG   Caulobacter sp. K31: Caul_0306Help
Entry
Caul_0306         CDS       T00651                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cak  Caulobacter sp. K31
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Caul_0306
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Caul_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
342698..343606
Genome map
AA seq 302 aa AA seqDB search
MATGPVVIAGSATLDYVARVEGDFAGRGTLLMRQGAGDAWPRAGGAALYAGGALAAAGVA
AAPLTWIGEDADGAAYREACRRGGVALDGVAVVEGASSTRCLLIYNADGTYGCLLRPGLA
VLTDAQLDLATRASWLAISAGPPEILRRLVGVRAPGARLAWIAKDDPACFPSDLAAGLAD
HADVVFCNAGERAWLEAARTLPRPAGQVLFETRGAAGVFVEGPEGAFHQPVSPIEVDDAT
GAGDSFAGAALAVLARDGSARTAAEAGVAAAGALLAARAFSSEVGAGSREENASKQKPRA
PA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggggccggtggtgatcgcggggtccgcgaccctggactatgtggcgcgggtc
gagggcgatttcgccggtcgcggcacgctgttgatgcgccagggcgcgggcgacgcctgg
cccagggccggcggcgcggcgctctatgccgggggtgccttggcggcggccggcgtcgcg
gcggcgcccctgacctggatcggcgaggacgccgacggcgcggcctatcgcgaggcctgt
cggcgcggcggggtggcattggatggcgttgcggtcgtggagggcgcgtcctccacccgc
tgcctgctgatctacaacgcggatgggacctatggctgcctgttgcggcccggcctggcc
gtgctgaccgacgcccagttggacctggcgacccgtgcgtcctggctggcgatcagcgcc
gggccaccggagatcctgcggcgcctggtcggcgttcgggcgcccggcgcgcgcctggcc
tggatcgccaaggatgacccggcctgtttccccagcgacctggccgcggggttggccgat
cacgccgatgtcgtgttctgcaacgccggcgaacgagcctggctggaggcggcgcgcacc
ctgcccaggccggcgggccaggtcttgttcgagacgcgcggcgcggcgggcgtgttcgtc
gagggtcccgagggggccttccaccagccggtctcgccgatcgaggtcgacgacgccacc
ggagccggcgacagcttcgccggcgcggctttggctgtgctggcgcgggacggttcggcg
cgcacggcggccgaggcgggcgtcgcggctgcgggcgcgcttctggcggcgagggcgttt
tcgagcgaagtgggcgccggttcgcgtgaagaaaatgcgtcgaaacaaaagcctagagcc
ccggcctga

DBGET integrated database retrieval system