KEGG   Caulobacter sp. K31: Caul_0414Help
Entry
Caul_0414         CDS       T00651                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
cak  Caulobacter sp. K31
Pathway
cak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caul_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABZ69551
JGI: Caul0414
UniProt: B0T5J3
Position
complement(454321..454701)
Genome map
AA seq 126 aa AA seqDB search
MRILTWLGATAFVFALPVSTQAAGDPARGKAAFSQCAACHAVEPSANRVGPSLAGVFGRK
KGSAAKFSYSSDLAAAGGTWDDKSLDAFLTDPKAAYPKAKMFLKVANPQTRADLVAYLKT
LKPAAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttgacctggctgggcgcgacggctttcgtgttcgccttgcccgtcagcacg
caggcggccggtgaccccgcccgaggcaaggcggcattttcgcagtgcgccgcctgccac
gcggtcgagccgagcgccaaccgcgtgggcccttcgttagccggcgtgtttggccgcaag
aagggctcggcggcgaagttcagctattcgagtgatctggccgctgcgggcggaacctgg
gacgacaagagtctggatgcgttcttgaccgatcccaaggccgcctatcccaaggccaaa
atgttcctgaaggtcgccaacccacaaacgcgcgcggatcttgtcgcctatctcaagacc
ctgaagccggccgcaaaatag

DBGET integrated database retrieval system