KEGG   Caulobacter sp. K31: Caul_0785Help
Entry
Caul_0785         CDS       T00651                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cak  Caulobacter sp. K31
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Caul_0785 (ruvA)
Enzymes [BR:cak01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Caul_0785 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
831284..831898
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGAVAEIGEEEALIDVMGVGYVVRCGSRTLQRLPALGEEALLHIESQWSESAGLR
LYGFGTREDRRAFVLLQAIQGVGPKAAMAVLDVLSPAELASAVAREDKAAVGRASGVGPK
LALRIVTELKDKPITDGPVLMTAPGAVAAAPAKAAPTGDAVAALMGLGVAEVNARRVVEA
AAAKLGDEATVQALIKAGLQELGR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttgcgaggggccgtcgccgagatcggcgaggaagaggcgctgatcgac
gtgatgggcgtcggctatgtcgtgcgctgcgggtcgcggaccctgcaacggctgccggcc
ctgggcgaagaggccctgctgcacatcgagagccagtggagcgagagcgccggcctgcgc
ctgtacggcttcggcacgcgcgaggaccgccgggccttcgtgctgctgcaggccatccag
ggcgtgggtcccaaggcggccatggcggtgctggacgtgctgtcgccggccgaactggcc
agcgcggtggcgcgcgaggacaaggcggcggtgggccgggcgtcgggcgtgggtcccaag
ctggctttgcggatcgtcaccgagctgaaggacaagccgatcaccgacgggccggtgctg
atgaccgcgccgggcgcggtggcggcggcgcccgccaaggcggccccgaccggcgacgcc
gtggcggcgctgatggggctgggcgtggccgaggtcaacgcccggcgggtggtcgaggcg
gcggcggcgaagctgggcgacgaggcgacggtccaggcgctgatcaaggctgggctgcag
gagctgggtcggtga

DBGET integrated database retrieval system