KEGG   Caulobacter sp. K31: Caul_0832Help
Entry
Caul_0832         CDS       T00651                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caul_0832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_0832
   00052 Galactose metabolism
    Caul_0832
   00500 Starch and sucrose metabolism
    Caul_0832
   00520 Amino sugar and nucleotide sugar metabolism
    Caul_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caul_0832
   00524 Butirosin and neomycin biosynthesis
    Caul_0832
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Caul_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(890916..891911)
Genome map
AA seq 331 aa AA seqDB search
MAQGTVLLADLNGRDLVVALARPGNPPSEHAVIPCATLAELEAILKARLAELAGEDLVGA
AISAAGPEIDGAITVTNTGLTLSQTWLRIVLRTPRVFLVNDLAACALGAPKVAESQLVMI
HPGKADRKGAIAVLGPDLGLGVAGLAPLRGGDGWMAVPSEGGHIDFCPAEPREVAIFAAV
RARHGDTAAERLLSKEGLGEIHEAIRQTGGLFSTPENDNAIIELARQGDTAALEAISVFS
GLLGGFAGDMALVFAARGGVYLNSPLLEQIGDLLDLKAFVRRFAAKGRMSGYLADVPVFV
MHGRPTLLGLSSLFSASDMRYEASEVKFLDC
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctcagggcaccgtcctgctcgctgatctgaacggccgcgacctcgtcgtggccttg
gcgcgtcccggcaacccgcccagcgagcacgccgtcattccttgcgccacgcttgccgaa
ctggaggccatcctcaaggcccggctggccgagctggccggcgaggatctggtcggcgcg
gcgatcagcgcggccggtccggagatcgacggcgcgatcaccgtcaccaacaccggcctg
accctgtcgcagacttggcttcgcatcgtcctgcgaaccccgcgcgtgttcctggtcaac
gacctggccgcctgcgcgctcggcgcgcccaaggtggcggaaagccagctggtcatgatc
catccgggaaaggccgaccgcaaaggcgccatcgccgtgctgggtcccgatctcggcctg
ggcgtggcggggctggcgcccctgcgcggcggcgacggctggatggccgtgcccagcgag
ggcggccacatcgatttctgccccgccgagccacgcgaggtcgcgatcttcgccgccgtg
cgggcgcggcacggcgacaccgccgccgagcgcctgctgtcgaaggaaggcctgggcgag
atccacgaggcgatccggcaaaccggcggcctcttttcgacgcctgaaaatgataacgct
atcattgagctcgcccgccagggcgacacggcggccctggaggcgatctcggtcttcagc
ggtctgctgggcggcttcgccggcgacatggcgctggtgttcgcggcgcgcggcggggtc
tatctgaacagcccgctgctggagcagatcggcgacctgctggacctgaaggccttcgtc
cggcggttcgccgccaagggacggatgagcggctatctggccgacgtgccggtgttcgtc
atgcatggccgcccgaccctgctgggcctgtccagcctcttctccgccagcgacatgcgc
tacgaggcctcggaggtgaagttcctcgactgctga

DBGET integrated database retrieval system