KEGG   Caulobacter sp. K31: Caul_1207Help
Entry
Caul_1207         CDS       T00651                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_1207
   00030 Pentose phosphate pathway
    Caul_1207
   00051 Fructose and mannose metabolism
    Caul_1207
   00052 Galactose metabolism
    Caul_1207
   00500 Starch and sucrose metabolism
    Caul_1207
   00520 Amino sugar and nucleotide sugar metabolism
    Caul_1207
  Nucleotide metabolism
   00230 Purine metabolism
    Caul_1207
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caul_1207
Enzymes [BR:cak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Caul_1207
    5.4.2.8  phosphomannomutase
     Caul_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1269773..1271269)
Genome map
AA seq 498 aa AA seqDB search
MFSKPRADLVANTAAYENEPLVKATGFREYDARWLFGPEINLLGIQALGLGLGTYIHELG
QSKIVVGHDFRSYSSSIKNALMLGLISAGCEVHDIGLALSPTAYFAQFDLDIPCVAMVTA
SHNENGWTGVKMGAQRPLTFGPDEMGRLKEIVLGGQFVERDGGKLIRVEGMAERYIADVA
KRAQLKRPLKVIAACGNGTAGAFAVDALQRMGVTEVIGMDTELDYTFPKYNPNPEDLEML
HSMAAAVRESGADLAFGFDGDGDRCGVVDDEGEEIFADKIGLMLARDLAPLHPGATFVVD
VKSTGLYATDPILAANGCKVIYWKTGHSYIKRKSAETGALAGFEKSGHFFMNKPLGLGYD
CGLTAAAAVLAMLDRNPGKKLSDLRKALPVAYTSLTMSPHCDDEKKYGVVADVVKEYEDL
FAAGGSILGRKIKEVITVNGVRVHLEDGSWVLVRASSNKPEVVVVVESTQSEDDMRALFH
KEVKPRLGDRVGKYNQEI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaagccccgtgccgatctcgtcgccaataccgccgcctacgagaatgaaccc
ttggtcaaggccacgggcttccgcgaatacgacgcgcgctggctgttcgggccagagatc
aaccttctgggcatccaggccctgggcctgggactgggaacctacatccacgaactgggc
cagtcgaagatcgtggtcggtcacgacttccgctcctattccagctcgatcaagaacgcg
ctgatgctgggcctgatcagcgccggctgcgaggtccacgacataggcctggccctgtcg
cccaccgcctatttcgcccagttcgacctggatatcccctgcgtggccatggtcaccgcc
agccacaacgagaacggctggaccggcgtcaagatgggcgcccagcgtcccctgaccttc
ggccccgacgagatgggccgcctgaaggagatcgtgctgggcggccagttcgtcgagcgt
gacggcggcaagctgatccgcgtcgagggcatggccgaacgctacatcgccgacgtcgcc
aagcgcgcccagttgaagcggccgctaaaggtgatcgccgcctgcggcaacggcacggcc
ggcgccttcgccgtcgacgccctgcagcgcatgggcgtgaccgaggtgatcggcatggac
acggaactcgactacaccttcccgaaatacaatccgaacccggaagacctggaaatgctg
cactcgatggccgcggccgttcgggaaagcggcgcggacctggcgttcggcttcgacggc
gacggcgaccgctgcggcgtggtcgacgacgagggcgaggaaatcttcgccgacaagatc
ggcctgatgctggcccgcgacctggccccgctgcacccgggcgcgaccttcgtggtcgac
gtcaagtcgaccggcctctacgccaccgatccgatcctggcggccaacggctgcaaggtg
atctactggaagaccggccacagctacatcaagcgcaagagcgccgagaccggggccttg
gccggcttcgagaagagcggccacttcttcatgaacaagcccctgggcctgggctacgac
tgcggactgaccgccgccgccgccgtgctggccatgctggaccgcaatcccggcaagaag
ctgtcggacctgcgcaaggccctgccggtcgcctacacctcgctgaccatgagcccgcac
tgcgacgacgagaagaagtatggcgtcgtcgccgacgtggtgaaggaatacgaggatctg
ttcgccgccggcggttcgatcctgggtcggaagatcaaggaagtgatcaccgtcaacggc
gtgcgcgtgcacctggaagacggctcgtgggtcctggtccgcgcctcatccaacaagccc
gaagtggtggtcgtggtcgagagcacccagtcggaagacgacatgcgcgccctgttccac
aaggaagtgaagccgcgcctgggcgaccgggtcggcaagtacaaccaggagatctga

DBGET integrated database retrieval system