KEGG   Caulobacter sp. K31: Caul_1210Help
Entry
Caul_1210         CDS       T00651                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cak01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cak01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cak00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cak00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cak00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1272719..1273432
Genome map
AA seq 237 aa AA seqDB search
MPVLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIKAAGINLDEAFTSVQTR
AIRTGNLALDAAGQSFVPVTKDWRLNERHYGGLTGLNKAETAQKHGEEQVTIWRRSYDIP
PPPLAPGGEYDFGKDRRYAGKDLPDTESLKTTLTRVLPYWETAIAPKLKAGETILVAAHG
NSLRAIVKHLFDVPDDKIVHVEIPTGNPLVIDLDADLKPTGARYLDAARAQPLPAVG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctcgtcctgctccgccatggccaaagccagtggaatctcgaaaaccgcttc
accggctgggtggacgtcgacctgaccgccgagggcgaggcccaggcccgcaagggcggc
gaactgatcaaggcggccggcatcaacctcgacgaggccttcacctcggtccagacccgc
gcgatccgcaccggcaacctggcgctggacgccgccggccagagcttcgtgccggtgacc
aaggattggcgcctgaacgagcgtcactacggcgggctgacgggcctgaacaaggccgag
accgctcagaagcacggcgaggagcaggtgaccatctggcgccggtcctacgatatcccg
ccgccgcccctggcgcccggcggcgagtacgacttcggcaaggatcgccgctatgccggc
aaggacctgccggacaccgaaagcctgaagaccaccctgacccgcgtcctgccctactgg
gagaccgcgatcgcgcccaagctgaaggccggcgagacgatcctggtcgccgcccacggc
aattcgctgcgcgccatcgtcaagcatctgttcgacgtgcccgacgacaagatcgtccat
gtcgagatccccaccggcaatccgctggtcatcgacctggacgccgacctgaagccgacc
ggcgcccgctatctcgacgccgcccgcgcccagccgctgcccgcggtggggtga

DBGET integrated database retrieval system