KEGG   Caulobacter sp. K31: Caul_1219Help
Entry
Caul_1219         CDS       T00651                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cak  Caulobacter sp. K31
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cak00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1281109..1282071
Genome map
AA seq 320 aa AA seqDB search
MIGAAPLVSIPEAPVPDHGKAEWFSGADGATLRAAFFSPEGSPFQGRARGSVVVSPGRSE
PIEKYFEVVRDLQDRGFAVLVHDWRGQGLSHRALPDRLKGHAAGFKDFVGDYQALLAAFE
TRLPKPWIAMGHSMGGSLTMLALAMGETRFSAAVLSAPMLGLNTGGRPPRAARALAWTMA
RAGLAGDYVLGDKGDPFIQTFPADALTHDAARYGRFQAQVRANPDIALGGITWGWTDFAF
SACAWLRRSQGVEAVTIPVTIVGAGADSRVLVADEKAIAARLPRGRYLEIEDAFHEILIE
TDDRRAVFWTAFDETVGGVL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtgcggcgcctctggtctcgattcccgaggcgcccgttcccgatcacggcaag
gctgaatggttcagcggcgcggacggggcgaccctccgcgccgctttcttttcgcctgaa
ggctcgcccttccagggcagggcgcgaggctcggtggtggtcagccccggccgcagcgaa
ccgatcgagaagtatttcgaggtcgtccgggacctgcaggaccgtggcttcgcggttctg
gtccacgattggcgcggacaggggttgtcccatcgcgccctgccggaccggttgaagggc
cacgcggccggtttcaaggacttcgtcggcgactaccaggcgctgctggccgcgttcgag
acccggctgcccaagccctggatcgcgatgggccattcgatgggcggcagcctgacgatg
ctggccctggccatgggcgagacccgtttttccgccgcggtgctgtcggccccgatgctg
ggcctgaacaccggcggcaggccgccccgcgccgcccgcgccttggcctggaccatggcc
cgcgcgggcctggccggcgactatgtgctgggcgacaagggcgatcccttcatccagacc
ttccccgccgacgccctgacccacgacgcggcgcgctacggccggtttcaggcccaggtg
cgcgccaatccggacatcgccctgggcggcatcacctggggttggaccgatttcgcgttc
tccgcctgcgcctggttgcgccggagccagggcgtcgaggcggtgacgatcccggtgacg
atcgtcggggcgggcgctgacagccgcgttctggtcgccgacgagaaggccatcgccgcc
cgccttccgcgagggcgttatctcgagatcgaggacgccttccacgagatcctgatcgag
acggacgaccgccgggcggtgttctggacggcgttcgacgagacggttggcggtgttctc
taa

DBGET integrated database retrieval system