KEGG   Caulobacter sp. K31: Caul_1278Help
Entry
Caul_1278         CDS       T00651                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cak  Caulobacter sp. K31
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Caul_1278
Enzymes [BR:cak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Caul_1278
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Caul_1278
Lipid biosynthesis proteins [BR:cak01004]
 Fatty acid synthase
  Component type
   Caul_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1340779..1341450
Genome map
AA seq 223 aa AA seqDB search
MSSAAPRFLDRRQVLIGLAAVTQIAAAPALPSGAPVVTVLGDSITAGLGLPAQGAVPAQL
QAALTRMGVLAKVRAAGVSGDTSGGGLARVKFSVAPDTALCVVALGGNDLLQGIEPRVTK
ANLRAILQSLRSRRISAVLVGVGAPPLIGATYAREFNALYPALAREFSAPLYPNILAGVG
GQRRLMQGDGIHPNAAGARVIGEKLAPVVAQALKARPTQTAAR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgccgcaccgcgttttctcgatcgtcgccaggtcttgatcggcctggccgcc
gtcacccagatcgccgccgctccggcgcttccctccggcgcgcccgtggtgacggtgctg
ggcgactcgatcaccgccggcctgggcctgcccgcccagggcgcggtgcccgcccagttg
caggcggccctgacccggatgggcgtgttggccaaggtccgggcggccggggtgtcgggc
gacaccagcggcggcggcctggcgcgggtcaagttcagcgtcgccccggacaccgcgctc
tgcgtcgtcgccctgggcggcaacgatttgctgcaggggatcgagccccgggtgaccaag
gccaacctgcgcgccatcctgcagagcctgcgcagtcgcaggatcagcgcggtcctggtg
ggcgtcggcgcgccgccgcttatcggcgcgacctacgcccgggagttcaatgcgctgtat
cccgccctggcccgggaattctcggcgccgctctatcccaacatcctggcgggcgtcggc
ggccagcggcggctgatgcagggcgacggcatccatcccaacgcggcgggggccagggtc
atcggggaaaagctggcgccggttgtggcccaggcgctgaaggcccggccgacccagact
gcggctaggtaa

DBGET integrated database retrieval system