KEGG   Caulobacter sp. K31: Caul_1721Help
Entry
Caul_1721         CDS       T00651                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cak  Caulobacter sp. K31
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Caul_1721
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Caul_1721
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caul_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1810919..1812409
Genome map
AA seq 496 aa AA seqDB search
MGQPLILALDQGTTSTRAILFQADGKPVCDAGRPLRQSYPRDGWVEHDADEIYAACVGVL
RDTVEKCDRDSADIAALGITNQRETVVVWDKATGRPIHPAIVWQDRRTAGVCDRLRNAGH
EPAVTAATGLLLDPYFSGTKIAWILDNVPGARRRAEQGELLCGTIDCWVIWRLTGKASHV
TDATNASRTLLFDIEKQAWSDEMLALLDVPASLLPTVLDCAADYGQVTPDILGRPLPIRG
VAGDQQAALMGQGCIRPGEMKVTYGTGGFMLVNTGETRPRSASRLLTTVAARVGGRTTYA
LEGSIFVAGAAIQWLNEGLGVTGGPRGAEALARSARDGHGVVVVPAFTGLGAPWWDPEAR
GAVFGLTRDAGLAEIAQATFDSCVFQGRDLIEAMRADAPSAFDGAELRIDGGMAKSAWFS
QRLADLTGIPVHRASYQETTALGAALFAGVGAGVYASVEEAVQARPEAELLTPGMSANAR
EEAYARWLDALPRVRS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggccaacctctgatcctcgcgctcgatcagggcacgaccagcacccgggccatcctg
ttccaggccgacggcaagccggtgtgcgacgcggggcgacccctgcgccagagctatccg
cgcgacggctgggtcgagcacgacgccgacgagatctacgctgcctgcgtgggcgtgctg
cgcgacacggtggagaaatgcgaccgcgacagcgccgacatcgccgctctgggcatcacc
aaccagcgcgagacggtggtggtctgggacaaggccaccggccgtccgatccatccggcc
atcgtctggcaggaccggcgcacggccggggtctgcgaccgtctgaggaacgcgggccac
gagcccgccgtcaccgccgccaccggcctgctgctggatccctatttctcggggaccaag
atcgcctggatcctcgacaacgtgcccggcgcgcggcggcgggcagagcagggcgaactg
ctgtgcggcacgattgattgctgggtgatctggcgcctgacggggaaggcctcacacgtc
accgacgccaccaacgcctcgcgcaccctgctgttcgacatcgagaagcaagcctggtcg
gacgagatgctggccctgctcgacgtaccggcgagcctgctgccgacggtgctggactgc
gccgccgactacggccaggtgacgcccgacatcctgggccgtcccttgccgatccgcggc
gtggccggcgaccagcaggcggcgctgatgggccagggctgcatccggcccggcgagatg
aaggtcacctacggcaccggcggcttcatgctggtcaacaccggcgagacccgtccgcgt
tccgcctcccggctgctgaccacggtggcggcgcgggtgggcgggcgcacgacctacgcc
ctggaaggctcgatcttcgtggccggggcggcgatccagtggctgaacgaggggctcggc
gtcaccggcggtccgcgcggggccgaggctctggcccgctcggcgcgtgacggccacggc
gtggtggtggtgccggccttcaccggcctgggcgcgccctggtgggaccccgaggcgcgc
ggggcggtcttcggcctgacccgagacgccggcctggccgagatcgcccaggccaccttc
gactcctgcgtcttccaggggcgcgacctcatcgaggccatgcgcgccgacgccccctcg
gccttcgacggcgccgagctgcgcatcgacggcggcatggccaagagcgcctggttcagc
cagcgcctggccgacctgaccggcattccggtgcaccgcgccagctaccaggagaccacg
gccctgggggcggccctgttcgccggggtcggggcgggagtctacgcctcggtcgaggag
gcggtgcaggcgcggccggaggcggaactgctgacgccgggcatgagcgccaacgcgcgt
gaggaggcctatgcccggtggctggacgcgctgccgagggtgcggtcctga

DBGET integrated database retrieval system