KEGG   Caulobacter sp. K31: Caul_1724Help
Entry
Caul_1724         CDS       T00651                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cak  Caulobacter sp. K31
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Caul_1724
Enzymes [BR:cak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Caul_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1813820..1814314
Genome map
AA seq 164 aa AA seqDB search
MVALGCSLPGSYPSREALLDSAINALPSEGLAVTGRSAWWTSAAWPDPTAPAYLNGVVLV
ETRASAEDVLAALHRIETRFGRVRAKPNAPRTLDLDLIAHGRTVLDGEVVVPHPRAHERL
FVMGPLAQVAPAWRHPLDGRTAAALAASASVGTDATPLAHIAKL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgccctcggctgcagcttgcccggatcctatccgagtcgcgaagctttgctggac
tccgcgatcaacgccctgccgtccgagggactggccgtgaccggacggtccgcctggtgg
acatcggcggcctggcccgatccgacggcgccagcctatctcaacggagtcgtcctggtc
gagacaagggcgtcggccgaagacgtcctggccgccctgcaccgcatcgagacccgcttc
ggccgcgtccgcgccaagccaaacgccccgcgcaccctggacctcgacctgatcgcccat
ggccgcacggtgttggacggggaggtggtcgttccccatccccgggctcacgagcgattg
ttcgtgatgggtccgctggcgcaggtggcgccggcctggcgccatccgctcgacggccgg
acggcggcggcgctggcggcgagcgcgagcgtcgggaccgacgcgacgccgcttgcgcac
attgccaaactttaa

DBGET integrated database retrieval system