KEGG   Caulobacter sp. K31: Caul_1844Help
Entry
Caul_1844         CDS       T00651                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cak  Caulobacter sp. K31
Brite
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Caul_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1963661..1964821
Genome map
AA seq 386 aa AA seqDB search
MAFRAPHVSRRDVIGLAAAATASAFAPGLAQAAGLSLGALAKAKGLRFGSAVGAGPVGSL
TGSFEDARYRQVLIDECGVLVPENELKWYVLRPDAKTFAFERADRIAAFAKAHDIALRGH
TLLWHHPKWFPAWLNAHDFGQGPAAAANADAMLVNHITKVVAHYPQIDSWDVVNETVDPK
DGSIRRTVFSDAMGQEQTLDVAFHAARAAAPKARLVYNDYMGWEAGNEAHRAGVLKLLEG
FRKRGTPVDALGVQSHLGTEDPAAPGSLGRPQEKQWRAFIDEATGMGYDLLITEFDVNDK
TLPADIAARDAAAASIAKAYLDLMLDYRQTKEVLAWGMIDKYSWLQNFTPRKDGLPLRGT
PYDDAYKPKLLRRAVAAAFRAAPSRA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttccgcgcacctcacgtctcacggcgagacgtcatcggcctcgccgccgccgcg
accgcgagcgccttcgcgccgggcttggcccaagcggccggattgtcgctgggcgccctg
gccaaggccaaggggctaaggttcggcagcgccgtcggcgccggcccggtcggttcgctc
actgggtccttcgaggatgcgcgctaccgccaggtgctgatcgacgaatgcggcgtgctg
gtccccgagaacgaactcaagtggtacgtgctgcggcccgacgccaagaccttcgccttc
gaacgcgccgatcgcatcgcggccttcgccaaggctcacgacatcgccctgcgcggccac
accttgctgtggcaccatcccaagtggttccccgcctggctcaacgcccacgacttcggc
cagggtcccgccgcggcggcgaacgccgatgccatgctggtcaaccacatcaccaaggtg
gtggcccactatccgcagatcgactcgtgggacgtggtcaacgagaccgtcgatccgaag
gacggctcgatccgccgcacggtcttttccgacgccatgggccaggagcagacgctcgac
gtcgccttccacgccgcccgcgccgccgcgcccaaggcccggctggtctataacgactac
atgggctgggaagccggcaacgaagcccaccgggcgggcgtgctgaagctgctggaaggc
tttcgcaagcgcgggacgccggtcgatgcgctgggcgtgcagagccatctgggaacggaa
gatcccgccgcgcccggcagtctgggccgaccccaggaaaagcagtggcgcgccttcatc
gatgaggcgaccggcatgggctacgacctgctgatcaccgagttcgacgtcaacgacaag
accctgccggccgacatcgccgcgcgcgacgcggccgccgcgtccatcgccaaggcctat
ctcgacctgatgctggactaccgccagaccaaggaggtgctggcctggggcatgatcgac
aaatattcgtggctgcagaacttcacgccgcgcaaggacggcctgcctctacgcgggacg
ccctatgacgacgcctacaagcccaagctattgcgccgggcggtggccgccgcgttccgg
gcggcgccgagccgcgcatga

DBGET integrated database retrieval system