KEGG   Caulobacter sp. K31: Caul_1913Help
Entry
Caul_1913         CDS       T00651                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
cak  Caulobacter sp. K31
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:cak00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2055591..2055989)
Genome map
AA seq 132 aa AA seqDB search
MSRAPIDIVRDFLDAWSAGPEPLEQAIRDLFRPDTEWLNMGLSKTVGADEALALGAKFEA
SMGYAKIIVDTLHIAAAGDVVLTERMDRLVAADGREIAAFSIAGVFELDDDGKLVRWRDY
TDPSAIGAIHSH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgccccgatcgacatcgttcgggactttctcgacgcctggtccgcgggccca
gagccgcttgagcaagcgatccgcgacctgttcaggccggacacggaatggctcaacatg
ggcctgtccaagacggttggcgccgatgaggccctggcgctgggcgcgaagttcgaggcc
agcatgggttatgcgaagatcatcgtggacactctgcacatcgccgccgcgggcgatgtc
gtcctgaccgagcggatggaccggcttgtcgccgccgacggacgcgaaatcgccgccttc
tctatcgccggcgtcttcgagctcgatgatgacggcaagctcgtccgatggcgcgactac
accgaccccagcgcgatcggcgcgatccacagccattga

DBGET integrated database retrieval system