KEGG   Caulobacter sp. K31: Caul_1914Help
Entry
Caul_1914         CDS       T00651                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cak  Caulobacter sp. K31
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Caul_1914
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Caul_1914
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Caul_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2056109..2056657
Genome map
AA seq 182 aa AA seqDB search
MTDPITAIPLTRNDGGTDALANHAGKVLLIVNVASKCGLTPQYEGLEALYRAKHAEGLEV
LAFPANNFNGQEPGADDEIADFCRTSYDITFPLYSKISVKGDDIHPLYAGLTAAKPETVG
DGPMRERLQGYGIATGGPGEVVWNFEKFLVGRDGQVIGRFAPDIDAADPRLLSAVDQALS
ED
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgatcaccgcgattcccctgacccgcaacgacggcggaacggacgctctg
gccaaccatgccggcaaggttctgctgatcgtcaatgtcgcgtcgaagtgcggattgacg
ccccagtacgaagggctcgaggcgctctatcgcgccaagcatgccgagggtctggaggtc
ctggcgttcccggccaacaacttcaacggccaagagccgggcgccgacgatgagatcgcg
gacttctgccggaccagctacgacatcaccttcccgctctattccaagatcagcgtcaag
ggtgacgatatccacccgctgtacgcgggcctgaccgcggcgaagccggagacggtcggg
gacggcccgatgcgcgagcggttgcaaggctacggcatcgcgacgggcggtcccggagaa
gtggtctggaacttcgagaagttcctggtcggtcgcgatgggcaggtgatcggacgcttc
gcgcccgacatcgacgcggcggatcctcgtctgctgagcgcggtggatcaggcgctgtcg
gaggactga

DBGET integrated database retrieval system