KEGG   Caulobacter sp. K31: Caul_1914Help
Entry
Caul_1914         CDS       T00651                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cak  Caulobacter sp. K31
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cak00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cak00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2056109..2056657
Genome map
AA seq 182 aa AA seqDB search
MTDPITAIPLTRNDGGTDALANHAGKVLLIVNVASKCGLTPQYEGLEALYRAKHAEGLEV
LAFPANNFNGQEPGADDEIADFCRTSYDITFPLYSKISVKGDDIHPLYAGLTAAKPETVG
DGPMRERLQGYGIATGGPGEVVWNFEKFLVGRDGQVIGRFAPDIDAADPRLLSAVDQALS
ED
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgatcaccgcgattcccctgacccgcaacgacggcggaacggacgctctg
gccaaccatgccggcaaggttctgctgatcgtcaatgtcgcgtcgaagtgcggattgacg
ccccagtacgaagggctcgaggcgctctatcgcgccaagcatgccgagggtctggaggtc
ctggcgttcccggccaacaacttcaacggccaagagccgggcgccgacgatgagatcgcg
gacttctgccggaccagctacgacatcaccttcccgctctattccaagatcagcgtcaag
ggtgacgatatccacccgctgtacgcgggcctgaccgcggcgaagccggagacggtcggg
gacggcccgatgcgcgagcggttgcaaggctacggcatcgcgacgggcggtcccggagaa
gtggtctggaacttcgagaagttcctggtcggtcgcgatgggcaggtgatcggacgcttc
gcgcccgacatcgacgcggcggatcctcgtctgctgagcgcggtggatcaggcgctgtcg
gaggactga

DBGET integrated database retrieval system