KEGG   Caulobacter sp. K31: Caul_2067Help
Entry
Caul_2067         CDS       T00651                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cak  Caulobacter sp. K31
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Caul_2067
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Caul_2067
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Caul_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2207303..2208745
Genome map
AA seq 480 aa AA seqDB search
MTIKVPVRRPAARLGAAALLLGLAACATTPPVVPTHAGAWITTADRSQMLAAQPALVFGS
EDVALGLPVITVDAAERHQSMVGFGAAITDASAWLIQNRLTPDQREQLLRELYGRGEGEL
GFSFTRLTIGASDFSSEHYSLDDAPGGAADPELAHLSLGRPAQAVFPTVRQVLAINPDLK
VMASPWSAPAWMKTTGSLIKGQLKSEAYPTYARFFVRYVDGAAKLGVPIDYLSIQNEPDF
EPENYPGMRWGAADRARFIGENLGPAFKQHGVRTRILEWDHNWDQPQQPLTALADPKAAP
FIAGVAWHCYAGDVAAQAKVAGAHPDKDVFFTECSGGDWSGPFDESFGWLMRNLVIGSTR
NGARGVLMWNLALDETHGPHKGGCGDCRGVVTIDSRTGAITRNPEYYAFGHASRFVRPGA
VRIDSSETASLPSVAFRNPDGGRVLVVFNSGKDRQAFSVREGGRVAKTSLPGGAAATFVW
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaagtccctgttcgacgcccagccgcgcgcctcggcgcggcggccctgctg
ctaggtctggcggcctgcgcgaccacgccgccggtcgtccccacccacgcaggagcatgg
atcaccacggcggaccggagccagatgctggcggcgcagcccgccctggtcttcgggtca
gaggacgtcgccctggggctgccggtgatcaccgtcgacgccgcggaacgccaccagagc
atggtcggtttcggcgcggcgatcaccgacgcctcggcctggctgatccagaaccggctg
acgcccgaccagcgcgagcaattgctcagggagctctatgggcggggcgagggggagctc
ggcttcagcttcacgcgcctgacgatcggcgcctcggatttctcgtccgaacactacagc
ctcgacgacgcgccgggcggcgcggccgatccggagctggctcacctgtcgctgggccgt
ccggcgcaggcggtcttcccgaccgtcaggcaggtcctggcgatcaatcctgatctcaag
gtcatggcctcgccctggagcgccccggcctggatgaagaccaccggctcgctgatcaag
ggccagctgaaatccgaggcctatccgacctatgcccgcttcttcgtgcgctatgttgac
ggggcggccaagctgggcgtgccgatcgactatctgagcatccagaacgagccggacttc
gagccggagaactatcctggcatgcgctggggcgcggccgatcgggcgcggttcatcggc
gagaacctggggccggcgttcaagcaacatggcgtgcggacccggatcctcgaatgggac
cacaactgggaccagccgcagcagcccctgaccgcgctggccgatccgaaggccgcgccg
ttcatcgccggcgtggcctggcactgttacgccggcgacgtcgccgcccaggccaaggtc
gccggcgcccatcccgacaaggacgtgttcttcaccgaatgctcgggcggcgactggtcg
ggtccgttcgacgaaagcttcggctggctgatgcgcaacctggtgatcggctccacccgc
aacggcgcccggggcgtgctgatgtggaacctggcgcttgacgaaacccacggaccgcac
aagggcggatgcggggactgtcggggcgtggtgaccatagacagccgcaccggcgcgatc
acccgcaaccccgaatactacgcctttggacacgccagccggttcgtgaggccgggcgcc
gtacggatcgactcgtcagaaaccgcgagcctgccgagcgtcgccttccgcaatcccgac
ggcggtcgcgtgctggtcgtcttcaattccggcaaggatcgccaggcgtttagcgtccgc
gagggcggtcgggtcgccaagacctcgctgccaggcggcgccgcggcgacgtttgtctgg
tag

DBGET integrated database retrieval system