KEGG   Caulobacter sp. K31: Caul_2129Help
Entry
Caul_2129         CDS       T00651                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cak  Caulobacter sp. K31
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cak00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cak00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cak00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2296299..2297522
Genome map
AA seq 407 aa AA seqDB search
MDRVSKPAARSLGRIISTLAALSLLMVAGLAHADDPPPPLKDNGLARTPPMGWNSWNRFA
CDVDETLIRKTADAMVSSGMRDAGYQYVVIDDCWHGARDAHGDIQPDPKRFPSGMKALGD
YIHSRGLKFGIYSDAGLKTCGGRPGSWGHEYQDAKQYAAWGVDYLKYDWCMAGTQDARSA
YYIMSSALQASGRDIVLSICEWGTSKPWLWADKVGNLWRTTGDIYDKWEGVRDYSSGVMN
IIDKQVELYPYARPGHWNDPDMLEVGNGGMTTEEYRSHFSLWAMLAAPLIAGNDIAAMDA
ETKAILTNREVIAIDQDSLGQQARRVSKTGDLEVWVRPLQGGGRAVVLLNRGPAPAPIRL
DWSQLDYPPTLKARVRDLWTGKDVGVREASYQATVASHGVAMLKIQP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgtgtgtcaaagccggcggcgcggtcgcttggtaggatcatctctacgctcgcg
gctctgtcgcttttgatggtcgcgggcctagcccacgcggacgatccgccgccgcccttg
aaggacaacggcttggcccgcacgccgccgatggggtggaacagctggaacaggttcgcc
tgcgatgtcgacgagacgctgatccgcaagaccgccgacgcgatggtcagttcgggcatg
cgcgacgcgggctatcagtacgtggtcatcgacgattgctggcatggcgcgcgcgacgcg
catggcgacatccagcctgatcccaagcgctttcccagcggcatgaaggcgctgggcgac
tacatccattccagggggctaaaattcggcatctattcggacgccggtttgaagacctgc
ggcggccggcccggcagctgggggcatgaatatcaggacgccaagcaatacgccgcctgg
ggcgtggactacctcaaatacgactggtgcatggctggcacgcaggacgcccgttcggct
tactacatcatgtcttcggcgctgcaggcgagcggccgagacatcgtgctgtcgatctgc
gaatgggggacgtccaagccgtggctgtgggccgacaaggtcggcaatctctggcggacc
acgggcgacatttacgacaagtgggagggcgtacgcgactacagctccggcgtcatgaac
atcatcgacaagcaggtcgaactctatccctacgcccgtccaggtcattggaacgatccg
gacatgctcgaggtcggcaacggcggcatgaccaccgaggagtatcgttcgcacttcagc
ctgtgggccatgctggccgcgccgctgatcgctggtaacgacatcgccgccatggacgcg
gagaccaaggcgatccttaccaatagggaagtgatcgccatcgatcaggattcgctcggc
cagcaggcgcggcgggtttccaagactggagaccttgaggtctgggtcaggccgttgcag
ggcggaggcagggcggtcgtcctgctcaatcgcggcccggcgccggcgccgatccgtctg
gactggagccagttggattatccgcccacgctaaaggccagggttcgcgacctctggacg
ggcaaggatgtcggcgtgcgcgaggcgagctatcaggcaaccgtcgcctcgcacggcgtc
gccatgctcaaaatccaaccttga

DBGET integrated database retrieval system