KEGG   Caulobacter sp. K31: Caul_2129Help
Entry
Caul_2129         CDS       T00651                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cak  Caulobacter sp. K31
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Caul_2129
  Lipid metabolism
   00561 Glycerolipid metabolism
    Caul_2129
   00600 Sphingolipid metabolism
    Caul_2129
Enzymes [BR:cak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Caul_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2296299..2297522
Genome map
AA seq 407 aa AA seqDB search
MDRVSKPAARSLGRIISTLAALSLLMVAGLAHADDPPPPLKDNGLARTPPMGWNSWNRFA
CDVDETLIRKTADAMVSSGMRDAGYQYVVIDDCWHGARDAHGDIQPDPKRFPSGMKALGD
YIHSRGLKFGIYSDAGLKTCGGRPGSWGHEYQDAKQYAAWGVDYLKYDWCMAGTQDARSA
YYIMSSALQASGRDIVLSICEWGTSKPWLWADKVGNLWRTTGDIYDKWEGVRDYSSGVMN
IIDKQVELYPYARPGHWNDPDMLEVGNGGMTTEEYRSHFSLWAMLAAPLIAGNDIAAMDA
ETKAILTNREVIAIDQDSLGQQARRVSKTGDLEVWVRPLQGGGRAVVLLNRGPAPAPIRL
DWSQLDYPPTLKARVRDLWTGKDVGVREASYQATVASHGVAMLKIQP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgtgtgtcaaagccggcggcgcggtcgcttggtaggatcatctctacgctcgcg
gctctgtcgcttttgatggtcgcgggcctagcccacgcggacgatccgccgccgcccttg
aaggacaacggcttggcccgcacgccgccgatggggtggaacagctggaacaggttcgcc
tgcgatgtcgacgagacgctgatccgcaagaccgccgacgcgatggtcagttcgggcatg
cgcgacgcgggctatcagtacgtggtcatcgacgattgctggcatggcgcgcgcgacgcg
catggcgacatccagcctgatcccaagcgctttcccagcggcatgaaggcgctgggcgac
tacatccattccagggggctaaaattcggcatctattcggacgccggtttgaagacctgc
ggcggccggcccggcagctgggggcatgaatatcaggacgccaagcaatacgccgcctgg
ggcgtggactacctcaaatacgactggtgcatggctggcacgcaggacgcccgttcggct
tactacatcatgtcttcggcgctgcaggcgagcggccgagacatcgtgctgtcgatctgc
gaatgggggacgtccaagccgtggctgtgggccgacaaggtcggcaatctctggcggacc
acgggcgacatttacgacaagtgggagggcgtacgcgactacagctccggcgtcatgaac
atcatcgacaagcaggtcgaactctatccctacgcccgtccaggtcattggaacgatccg
gacatgctcgaggtcggcaacggcggcatgaccaccgaggagtatcgttcgcacttcagc
ctgtgggccatgctggccgcgccgctgatcgctggtaacgacatcgccgccatggacgcg
gagaccaaggcgatccttaccaatagggaagtgatcgccatcgatcaggattcgctcggc
cagcaggcgcggcgggtttccaagactggagaccttgaggtctgggtcaggccgttgcag
ggcggaggcagggcggtcgtcctgctcaatcgcggcccggcgccggcgccgatccgtctg
gactggagccagttggattatccgcccacgctaaaggccagggttcgcgacctctggacg
ggcaaggatgtcggcgtgcgcgaggcgagctatcaggcaaccgtcgcctcgcacggcgtc
gccatgctcaaaatccaaccttga

DBGET integrated database retrieval system