KEGG   Caulobacter sp. K31: Caul_2147Help
Entry
Caul_2147         CDS       T00651                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cak  Caulobacter sp. K31
Brite
Enzymes [BR:cak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Caul_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2326402..2326974
Genome map
AA seq 190 aa AA seqDB search
MSSDFAAARLNMVESQIRTADVTDLPLQDALRVVPREACVPAGKGYLAYADADVEYAPGR
WLLRPREVGKLLQNLRPREGDKALAIAAPYAAAVLEKMGLQVTRLDGDDLTAVTGADYDV
IICEGAVPRAPASWAKALAVGGRLGVVERDGPVGRAVIYVRAEDGVGSRAVFDATPPLLA
GFSVEQGFAF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgatttcgccgccgcgcgcctcaacatggtcgaaagccagatccgcacggcc
gacgtcaccgacctgcccctgcaggacgccttgcgcgtcgtgccgcgcgaggcctgcgtg
ccggccggcaagggctacctggcctatgccgacgccgacgtcgaatacgcccccggccgc
tggctgctgcgcccgcgcgaggtgggcaagctgctgcagaacctgcgtccccgcgagggc
gacaaggccctggccatcgccgccccctatgcggcggccgtgctggagaagatgggcctc
caggtcacccgcctggacggcgacgacctgaccgccgtcaccggcgccgactatgacgtc
atcatctgcgaaggcgccgtgccgcgggcgccggccagctgggccaaggccctggcggtc
ggcggtcgattgggcgtggtcgagcgcgatggaccggtcggtcgggcggtgatctatgtt
cgcgccgaggacggcgtgggcagccgtgctgttttcgacgccacgccgccgctgctcgcc
ggtttctccgtcgaacaggggtttgcattttag

DBGET integrated database retrieval system