KEGG   Caulobacter sp. K31: Caul_2461Help
Entry
Caul_2461         CDS       T00651                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cak  Caulobacter sp. K31
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Caul_2461
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caul_2461
  Lipid metabolism
   00071 Fatty acid degradation
    Caul_2461
  Amino acid metabolism
   00350 Tyrosine metabolism
    Caul_2461
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Caul_2461
   00626 Naphthalene degradation
    Caul_2461
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Caul_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2682358..2683392
Genome map
AA seq 344 aa AA seqDB search
MDKTMRAAVVRAFGQALVVEDVARPKPGRGQVLVKIAACGVCHTDLHAAHGDWPIKPSLP
LIPGHEGVGTVVQVGKGVEHVKEGDRVGVPWLHTACGHCVHCLGGWETLCEAQQNTGYSV
NGGFAEYVLADADYVGHLPANLSFLEVAPILCAGVTVYKGLKVTDAKPGDWVAISGIGGL
GHMAVQYAKAMGFKVAAVDIDEDKLRLARSLGTEITVNARETDPGPYLQKEIGGAQGVLV
TAVSPIAFSQALGMVRRGGTVSLNGLPPGDFPLSIFDTVLRGITVRGSIVGTRLDLQEAL
AFAADGRVRATVHAEGLDNINSVFERMARGEIEGRVVLDFEDRL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaccatgagggccgcggtcgttcgggcctttggccaggcgctggtcgtggaa
gacgtggcgcggcccaagcccggtcgcggtcaggtgttggtcaagatcgccgcgtgcggg
gtctgccacaccgatctgcacgccgcccacggcgactggcccatcaagcctagccttccg
ttgattccgggtcacgagggcgtgggtacggtggttcaggtcggaaagggcgtggagcac
gtcaaggaaggtgatcgcgttggcgtgccctggctgcacacggcctgcggtcattgcgtc
cactgcctgggcggctgggagaccctctgcgaggcgcagcagaacaccggctattcggtc
aatggcggcttcgctgaatatgtgctggccgacgccgactatgtcggccatctgcccgcc
aatctgagcttcctggaggtggcgccgatcctctgcgccggtgtcacggtctacaagggc
ttgaaggtcaccgatgccaagcccggcgactgggtggcgatttccggcattggcgggctg
ggccacatggccgtgcaatacgccaaggccatgggcttcaaggtcgccgccgtcgatatc
gacgaggacaagcttcgtctggcgcggagcctgggcaccgagatcacggtcaacgccagg
gagaccgaccctggcccctacctgcagaaggaaatcggcggcgcccaaggcgtcctggtc
accgccgtgtcgcccatcgccttctcccaggctctgggcatggttcggcgcggcggcacg
gtgtcgctcaatggcctgccgccgggcgatttcccgctgtcgatcttcgacacggtgctg
cgcgggatcaccgtgcgcggctcgatcgtcggcacgcggctggacctgcaggaggccctg
gccttcgccgccgacggccgcgtgcgggccacggtccatgctgaggggctggacaacatc
aacagtgtcttcgagcgcatggcacgcggcgaaatcgagggacgcgtggtgctcgacttc
gaggatcggctgtga

DBGET integrated database retrieval system